1. DNA: ATACGAAATCGCGATCGCGGCGATTCGG mRNA: Codon: Anticodon: Amino Acids: 2. DNA: TTTACGGCCATCAGGCAATACTGG mRNA: Codon: Anitcodon: Amino Acids:
Q: Chemistry Most of the reactions in gluconeogenesis are the simple reversal of the ‘forward’…
A: In gluconeogenesis pathway, the formation of phosphoenolpyruvate from oxaloacetate is catalyzed by…
Q: discuss the biochemistry behind disorders related to aromatic amino acids with an aid of an…
A: The major aromatic amino acids are phenylalanine, tyrosine, and tryptophan. Defect in the enzymes of…
Q: Name the three major types of membrane lipids in animal cells and provide a specific example of…
A: The cell membrane is composed of lipids and proteins. A small amount of carbohydrates is also…
Q: Which of the following statements about protein folding is incorrect? Select all. GroEL/GroES allow…
A: The proteins fold into their proper three dimensional structure in order to be biologically active.…
Q: Proteins form plant sources are Always complete dietary protein Seldom complete dietary protein It…
A: Proteins are substantial, intricate molecules that are essential to numerous bodily processes. They…
Q: Need help, please.
A: Malate dehydrogenase is an enzyme that catalyzes the final reaction of the TCA cycle. In the first…
Q: What charged groups are present in glutamate at a pH = 7? OA) 1× NH3+ B) 1 x COOT C) 1× NH3 and 1 x…
A: Glutamate is an amino acid with molecular formula C5H9NO4. It is considered as acidic amino acid due…
Q: of the gluconeogenesis wing is not true? A. Phosphofructokinase-1 (PFK-1) and…
A: Glycolysis - is a process in which one mole of glucose is partially oxidized into two moles of…
Q: How many cycles of the synthesis pathway are needed to produce lauric acid, C₁1H23COOH? ||…
A: The production of triglycerides from acetyl-coenzyme A (acetyl-CoA) subunits is known as…
Q: 5-45 A sample of an unknown peptide was divided into two aliquots, acid. One aliquot was treated…
A: Edman degradation method is used for the sequencing of polypeptide chains. For larger proteins the…
Q: 4) For various amino acid pairs (for example: F to A, E to R, D to N, V to L, S to W), ask yourself:…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: Lipids supply more than twice as many calories as carbohydrates. Based on the results of the Sudan…
A: Sudan III is a dye that is used to stain lipids. When Sudan reagent is added to a solution…
Q: Give the isoelectric points of following 2 tripeptides DRI and RID.
A: pI (isoelectric point) of an amino acid is the PH at which the amino acid carries zero net charge. A…
Q: 1a Briefly describe or explain what the term "supercoiling" means in the context of DNA structure.…
A: Supercoiling means the coiling of the coil. Cellular DNA is extremely compacted and implies a high…
Q: Studies of a specific enzyme activity showed that the time the enzyme activity before complete…
A: An organic substance called an enzyme acts as a catalyst for a biological reaction. Each cell in the…
Q: How can chirality and stereoisomers influence the pharmacology, bioactivity, toxicology,…
A: Ibuprofen is a Non-Steroidal Anti-Inflammatory Drug (NSAID). Ibuprofen does this function by…
Q: 2. The attached figure is a titration curve for the amino acid glycine. At which pH is glycine…
A: Amino acids are biomolecules that have an amino group, a carboxyl group and a side group that is…
Q: 6. Study the cycle below and answer the following 6.1 Provide a definition for the citric acid cycle…
A: - The Krebs cycle, also known as the TCA cycle (tricarboxylic acid cycle) or the Citric acid cycle,…
Q: What is the net ionic charge for the peptide at pH 5 and pH 11? The peptide is…
A: A peptide is a short chain of amino acid residues linked via a peptide bond. As a general rule of…
Q: For the tetrapeptide YIRG: a. Draw its complete protonic equilibria. Indicate the net charge of each…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: What is epistasis, and what is pleiotropy? Describe with examples.
A: “Since you have asked multiple question, we will solve the first question for you. If youwant any…
Q: Consider a uniport system where a carrier protein transports an uncharged substance A across a cell…
A: ∆G = R T ln (Ainside /Aoutside) Where G is free energy change for the transport of uncharged…
Q: What is binding energy? What do negative and less negative energies represent? How does this relate…
A: Binding energy is the amount of energy required to separate a system into its constituents. If we…
Q: 1. What is the superhelical density (o) of a closed-circular DNA with a length of 4,200 bp and a…
A: Supercoiling is the coiling of a coil. Now, whether the coil coils in a left-handed direction or…
Q: See the oligopeptide below. Compare the quantities of high energy molecules (e.g. ATP/ADP/AMP,…
A: Oligopeptides: It contains from two to twenty amino acids and may be made up of dipeptides,…
Q: 8. Which of the following members of the ETC does not pump any protons into the intermembrane space?…
A: Electron Transport Chain (ETC). This component of aerobic respiration and the only component of…
Q: is the statement true or false?
A: The pentose phosphate pathway carries out the complete oxidation of glucose by completely oxidizing…
Q: What is the principle involved in mucic acid test?
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified into monosaccharides,…
Q: Use the data below to answer the following question: How much more energy is stored in a gram of fat…
A: A heterogeneous class of substances with comparatively similar physical characteristics are referred…
Q: AMP is an activator of fructose 1,6-bisphosphatase (FBPase-1) True False
A: Glycolysis is the process by which one molecule of 6 carbon glucose is broken down into 2 molecules…
Q: Even though HbA is a heterotetramer (not all the subunits are the same), the alpha- and beta-globin…
A: Haemoglobin is a carrier protein that carries oxygen to the cells . It is present in red blood cells…
Q: You have dialysis tubing that is permeable to water but not sucrose that contain 10 mL of varying…
A: Osmosis is a process of movement of water from higher water concentration to lower water…
Q: What is one technique or property of a protein that you could use to monitor the fractions so you…
A: In column chromatography, there is a stationary phase and the mobile phase. The stationary phase…
Q: 10. The final electron acceptor in the electron transport chain is Complex IV. T F
A: The final stage of aerobic respiration is the electron transport chain (ETC), which is also the sole…
Q: What does bleach do to hair
A: Melanin, the pigment that also affects the colour of your skin, also determines the colour of your…
Q: Formation of a GC-rich stem-loop in the mRNA is required for function of an intrinsic transcription…
A: Transcription is the process in which mRNA corresponding to a gene is synthesized by RNA Polymerase.…
Q: Conversion of disaccharides to monosaccharides are associated with: O stomach O intestinal mucosa…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula :…
Q: DNA: Explain the Meselson-Stahl Experiment.
A: The mode of replication in DNA, in which a parental duplex DNA gives rise to two identical daughter…
Q: Describe the signal transduction pathway for Two or Three of the following: a) ß-adrenergic…
A: Beta adrenergic receptor is a G-protein-coupled receptor communicating through the Gs alpha…
Q: H3C CH3 -(HC- H₂ H₂ -C-C -CH2)3- Pristanic acid CH3 IL.
A: Pristanic acid is a branched chain fatty acid . It is 2,6,10,14 tetra methyl Penta decanoic acid.…
Q: Provide 3 most applications/purposes of DNA analysis.
A: Recall that: DNA is the genetic material passed down from one generation to another, ie, the…
Q: The side chain of cysteine contains: OA) a hydroxyl group OB) an amine group C) a carboxyl group OD)…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Select the chemical consequences that could contribute to DNA instability at AP sites. fewer…
A: AP site is Apurinic site or Abase site at which nitrogen base is lost from the nucleotide of DNA and…
Q: 4. Below each item, identify WHAT it is, indicate WHERE in the cell it is used/made (cytoplasm or…
A: Glycolysis is the metabolic pathway that converts glucose into pyruvate. The free energy that is…
Q: Which of the following statements involving the properties of matter (physical or chemical) does NOT…
A: INTRODUCTION : Amylase - It is an enzyme that catalyses the reaction of hydrolysis of starch into…
Q: fructose-6-phosphate + ATP fructose-1,6- biphosphate + ADP AG = 30.5 and 16.3 respectively Standard…
A: The Gibbs free energy (G): It is the thermodynamic function that best captures the energetics of…
Q: 3. Given the following peptide sequence, GSICDNCR, the estimated net charge at the given pH is: a)…
A: Peptides: Organic substances known as amino acids include both amino and carboxylic acid functional…
Q: Question 11 of 25 Among the given statements, which are characteristics of plant cells? Select the…
A: Osmosis is the process of net movement of water across a semipermeable membrane This transport…
Q: How is aquaporin synthesised? List step by step. How is this protein made and targeted to its final…
A: Aquaporins (AQP) are protein channels that function in the transfer of water at very high rates…
Q: What is expected theoretical number of copies of DNA molecules after 28 cycles in a PCR experiment?…
A: INTRODUCTION: DNA : Its fullform is Deoxyribo nucleic acid and It has a double stranded helix…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- What is the complementary DNA sequence to the following DNA sequence? ATGCCATCG ____________________________ Write the mRNA codon sequence for the following DNA sequence. CTGCACTGA ____________________________ Write the anticodon tRNA sequence for the following mRNA sequence. UACGACUAG ____________________________ Name the amino acids that use the following mRNA codons. CAU ______________________________ AUG ______________________________ AAG ______________________________ CCC ______________________________ Name the amino acids that use the following DNA codons TAT ______________________________ CGA ______________________________ List the amino acid sequence for the following mRNA code. Be sure that you start with the first start codon you get to and then proceed to list the amino acids until you get to a stop codon. CGUAUGACUGGAAUACUUUAGCCAGCU __________________________________________________________________INSTRUCTION: = IF BOTH STATEMENT ARE TRUE = IF FIRST STATEMENT IS TRUE WHILE SECOND STATEMENT IS FALSE = IF FIRST STATEMENT IS FALSE WHILE SECOND STATEMENT IS TRUE = IF BOTH STATEMENTS ARE FALSE STAMENT 1: Amino acyl tRNA synthase is the enzyme responsible for joining amino acid together STAMENT 2: Nucleus is the part of the cell where translation takes place ANSWER: STAMENT 1: DNA sequences where RNA polymerase binds initially is called promoter sequences STAMENT 2: UV light causes adenine to dimerize ANSWER: STAMENT 1: Guanosine is the name of the compound formed when guanine is bonded to ribose STAMENT 2: DNA pairing is the term that refers to the process when two complementary and single stranded DNA combine ANSWER:State if the DNA is written 5' to 3' or 3' to 5' Transcribe the sequence. Include the 5' and 3' Translate the sequence (codon chart included) +1 TAGTCCAAAGGTTTACGTAAATGGGATGTCGAAATTGACTAGATCA
- In the following table, below each DNA nucleotide, type in the complementary mRNA nucleotides. Then, for each set of three DNA and complementary mRNA nucleotides, use the amino acid chart to translate the nucleotides into amino acids, and type them below. DNA T-A-C A-A-G A-T-G G-G-G A-T-T mRNA Enter Text — Enter Text — Enter Text Enter Text — Enter Text — Enter Text Enter Text — Enter Text — Enter Text Enter Text — Enter Text — Enter Text Enter Text — Enter Text — Enter Text Amino acid Enter Text Enter Text Enter Text Enter Text Enter TextUsing the mRNA sequence you made, translate this into a protein sequence. Begin translation at the first AUG (start codon) in the sequence, starting from the mRNA 5’ end. When writing the amino acids that are found in the protein, you may use the single-letter code, three-letter code, or full amino acid names.Transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain, identifying the codons, anticodons, and amino acid sequence. DNA: C G A T A C A A T G G A C C C G G T A T G C G A T A T C C mRNA: Codon: Anitcodon: Amino Acids:
- Transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain, identifying the codons, anticodons, and amino acid sequence. DNA: C G A T A C A A T G G A C C C G G T A T G C G A T A T C C mRNA: G C U A U G U U A C C U G G G C C A U A C G C U A U A G G Codon: Anitcodon: Amino Acids:Translate to amino acids the strand using the Genetic Code chart. Remember to use the start and stop sequences. UGCGAUGGCAAUCGGUGUACCCCUGACUGAGCExplain the process translation. A complete answer will include the words below tRNA, amino acid, polypeptide chain, ribosome, mRNA, codon, anticodon, nucleotides, base pairing rules, sequence
- Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"DNA A G T A C C G G G C A A A C T G C A T T G T G mRNA U C A U G G C C C G U U U G A C G U A A C A C Use the "Genetic Code Chart" to determine the sequence of amino acids in your polypeptide chain. Remember to START translation at the start codon by adding a Methionine and STOP translating when you reach a stop codon.transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain, identifying the codons, anticodons, and amino acid sequence. DNA: T A C G G G C C T A T A C G C T A C T A C T CA T G G A T C G G mRNA: Codon: Anitcodon: Amino Acids: