3. Amino Acid Sequence and Protein Structure Our growingunderstanding of how proteins fold allows researchers to makepredictions about protein structure based on primary amino acidsequence data. Consider the following amino acid sequence.135678 910Ile - Ala - His - Thr - Tyr - Gly - Pro - Phe-Glu – Ala--11121314151720Ala - Mat - Cys- Lys - Trp - Glu-Ala-Gln-Pro - Asp-1618 192122232425262728Gly - Met-Glu - Cys - Ala - Phe - His - Arg(a) Where might bends or ß turns occur?(b) Where might intrachain disulfide cross-linkages be formed?(c) Assuming that this sequence is part of a larger globular protein,indicate the probable location (external surface or interior of the protein)of the following amino acid residues: Asp, lle, Thr, Ala, Gln, Lys. Explainyour reasoning.

Proteins are made up of amino acids that are linked together by peptide bonds. The simple linear…

(a) Where might bends or 3 turns occur? (b) Where might intrachain disulfide cross-linkages be formed? (c) Assuming that this sequence is part of a larger globular protein, indicate the probable location (external surface or interior of the protein) of the following amino acid residues: Asp, lle, Thr, Ala, Gln, Lys. Explain your reasoning.

(a) Where might bends or 3 turns occur? (b) Where might intrachain disulfide cross-linkages be formed? (c) Assuming that this sequence is part of a larger globular protein, indicate the probable location (external surface or interior of the protein) of the following amino acid residues: Asp, lle, Thr, Ala, Gln, Lys. Explain your reasoning.

Biology 2e

2nd Edition

ISBN:9781947172517

Author:Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:Matthew Douglas, Jung Choi, Mary Ann Clark

Chapter3: Biological Macromolecules

Section: Chapter Questions

Problem 23CTQ: Amino acids have the generic structure seen below, where R represents different carbon-based side...

See similar textbooks

Similar questions

The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices unwind. c. sheet structures unfold. d. tertiary structure is changed. e. quaternary structures disassemble.
Amino acids have the generic structure seen below, where R represents different carbon-based side chains. Describe how the structure of amino acids allows them to be linked into long peptide chains to form proteins.
Mad cow disease is an infectious disease where one misfolded protein causes all other copies of the protein to being misfolding. This is an example of a disease impacting structure. primary secondary tertiary quaternary
Our growing understanding of how proteins fold allows researchers to make predictions about protein structure based on primary amino acid sequence data Consider the following amino acid sequence Ile-Ala-His-Thr-Tyr-Gly-Pro-Phe-Glu-Ala-Ala-Met-Cys-Lys-Trp-Glu-Ala-Gln-Pro-Asp-Gly-Met-Glu-Cys-Ala-Phe-His-Arg Where might reverse turns occur? Where might Intrachain disulfide linkages be formed? What will be the secondary structure formed from this sequence? Assuming that this sequence is part of a larger globular protein, indicate the probable location of the following amino acid residues: Asp, Ile, Thr, Ala. Gln, Lys.( Hint: see Hydropathy index)
5 (a) Describe in detail how you will determine the primary structure of protein. You have been given a mixture of lysine, histidine and cysteine. The isoelectric point of the amino acids are as follows: Histidine 7.64 Lysine 9.74 Cystenie 5.02 Show how you will separate the mixture into the pure forms. State and describe any instrument that you will use to separate the components in the mixture.
Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
I was given an amino acid position 564 with the PDC code 2V1X. Would it be possible to describe why this position in the protein is important and outline the effects the mutation will have on the structure / function of the protein? Thank you.
3a) Secondary (2°) structure in proteins refers to two specific conformations a region of a protein can take on, the a-helix and the b-pleated sheet. Briefly describe or explain how 2° structure forms/what causes 2° structure to form in a region of a protein.
3c) The 3 structure of a protein incorporates any 2 structure the protein has, but results primarily from interactions between amino acid side groups. Name two different amino acids whose side groups could participate in each type of interaction given below under physiological conditions (pH 7.2-7.5). Ionic bonding: Hydrophobic clustering: Hydrogen bonding:
3a) The 3° structure of a protein refers to the protein's overall, 3-dimensional shape in space. This will incorporate any 2° structure the protein has, but is predominantly the result of side-group interactions. Name the type of interaction, if any, that you would expect to see under physiological conditions (an aqueous solution at pH 7.0-7.5) between the following pairs of amino acid side groups. Serine and asparagine: Methionine and lysine: Glutamate and aspartic acid: Alanine and phenylalanine:
The three-dimensional conformation of a protein may be strongly influenced by amino acid residues that are very far apart in sequence. This relationship is in contrast to secondary structure, where the amino acid residues are: a. always side by side. b. generally near each other in sequence. c. invariably restricted to about 7 of the 20 standard amino acids. d. often on different polypeptide strands. e. usually near the polypeptide chain's amino terminus or carboxyl terminus.
Globular proteins are water-soluble, whereas fibrous proteins are insoluble in water. Indicate whether you expect the following amino acids to be on the surface of a globular protein or on the surface of a fibrous protein.(a) Ala (b) Glu(c) Leu (d) Phe(e) Ser (f) Val