-35 sequence -10 sequence +1 Transcribed lac operon TTTACA N7 TATGTT NG A lacl GCGCAA N7 CATGAT N, Al trp operon TTGACA N7 TTAACT N, A rrnX TTGTCT N16 TAATAT N7 Al TTGATA N46 TATAAT N, A recA lexA TTCCAA Ny7 TATACT NG A TRNA" TITACA N16 TATGAT N, Al Consensus TTGACA TATAAT sequence

-35 sequence -10 sequence +1 Transcribed lac operon TTTACA N7 TATGTT NG A lacl GCGCAA N7 CATGAT N, Al trp operon TTGACA N7 TTAACT N, A rrnX TTGTCT N16 TAATAT N7 Al TTGATA N46 TATAAT N, A recA lexA TTCCAA Ny7 TATACT NG A TRNA" TITACA N16 TATGAT N, Al Consensus TTGACA TATAAT sequence

Name: Mutations in bacterial promoters may increase or decrease the rate of
Uploaded: 2024-03-20T06:42:55.000Z
Channel: Bartleby
Description: Mutations in bacterial promoters may increase or decrease the rate of gene transcription. Promoter mutations that increase the transcription rate are termed up-promoter mutations, and those that decrease the transcription rate are termed down-promote

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter29: Transcription And The Regulation Of Gene Expression

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

GTTTTCACTGGCGAGCGTCATCTTCCTACT 8. What is the function (e.g. transcriptional regulation, transmembrane signaling, kinase, protease, etc.) of the protein(s) encoded by the gene.
88Sequential binding of RNA polymerase II-TFIIF complex, TFIIE, and TFIIH completes ___________________ formation. A.pre-initiation complexb.TF recognition elementc.pre-elongation complexD.TATA binding complex 89Which of the following is the GDP-GTP exchange protein?A.EF-Tub.none of the abovec.EF-TsD.EF-G 90RNA polymerase II has 14 subunits. Yesorno
11c all three of the classes or types of eukaryotic transcriptional regulators have alpha helical structure. name any two of the three major classes of eukaryotic transcriptional regulators.
Met-enkephalin (Tyr–Gly–Gly–Phe–Met) is a painkiller and sedative (Section 21.5). What is a possible nucleotide sequence in the template strand of the gene that codes for met-enkephalin, assuming that every base of the gene is transcribed and then translated?
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
Six strains of E. coli (mutants 1–6) that had one of thefollowing mutations (i–vi) affecting the lac operonwere isolated.i. deletion of lacYii. ocmutationiii. missense mutation in lacZiv. inversion of the lac operon (but not an inversion ofthe lacI gene)v. superrepressor mutationvi. inversion of lacZ, Y, and A but not lacI, P, oa. Which of these mutations would prevent the strainfrom utilizing lactose?b. The entire lac operon (including the lacI gene andits promoter) from each of the six E. coli strainswas cloned into a plasmid vector containing an ampicillin resistance gene. Each recombinant plasmidwas transformed into each of the six strains to create partial diploids. In analysis of these strains, mutant 1 was found to carry a deletion of lacY, so thisstrain corresponds to mutation i in the list above.Which of the other types of mutations would be expected to complement mutant 1 in these partial diploids so as to allow lactose utilization?c. In part (b), each strain was plated on…
94In the arrested state (7-14 nucleotides) of elongation, ( ) is required to reactivate transcription. 95C. elegans has about 19,000 genes, a significant number of which are organized into operons. Yesorno 96Transcription activator proteins have at least two independently folding domains: 1. DNA binding domain and 2.
Create a metabolism cocept map using these terms RepressorInducer RiboswitchRepression InductionPositive regulationActivatorOperator Heat shocklac operontrp operon Catabolite RepressionHeat shocksigma-32 Negative regulationTwo-component regulationSensor Kinase Autoinducing Peptide (AIP)Response regulatorSigma factorsFeedback inhibitionProtein StabilityQuorum SensingRNA regulationAntisense RNAHomoserine Lactone (AHL)
35. The genes shown are from the lac operon system of E.coli. The symbols a, b and c represent the repressor (I) gene, the operator (O) region, and the structural gene (Z) for β-galactosidase, although not in that order. Furthermore, the symbols written in the genotypes are not necessarily the actual sequence in the lac operon.
If the following truncated peptide represents the active domain of the COVID19’s S-protein N-terminal ----Leu-Leu-Gly-Cys-Ile-Glu-Ser-Thr-Cys-Ala ------ C-terminal a) state the RNA sequence of this peptide given that Leu is the first amino acid b) show a point mutation using the RNA sequence & explain how it results in silent mutation effect c) show a deletion mutation using the RNA sequence & explain the consequence(s)
⦁ Original: ATTTGAGCCMutated: ATTGAGCC. This is an example of what kind of mutation?
30 A DNA sequence encoding a five-amino acid polypeptide is given below. …ACGGCAAGATCCCACCCTAATCAGACCGTACCATTCACCTCCT… …TGCCGTTCTAGGGTGGGATTAGTCTGGCATGGTAAGTGGAGGA… b)Give the sequence and polarity of the mRNA encoding the polypeptide.