Based on what you know of scaffolding complexes, what would most likely happen if the Substrate Binding Arm of a ubiquitin ligase complex was mutated such that a small, non-polar amino acid in the binding surface that interacts with the adaptor protein is now a large, charged amino acid? A. The ubiquitin-conjugating enzyme would still bind to the complex. B. The substrate binding arm would not bind the adapter protein. C. The target protein would not be ubiquitylated D. all of the above. O E. A and B only

Based on what you know of scaffolding complexes, what would most likely happen if the Substrate Binding Arm of a ubiquitin ligase complex was mutated such that a small, non-polar amino acid in the binding surface that interacts with the adaptor protein is now a large, charged amino acid? A. The ubiquitin-conjugating enzyme would still bind to the complex. B. The substrate binding arm would not bind the adapter protein. C. The target protein would not be ubiquitylated D. all of the above. O E. A and B only

Biology (MindTap Course List)

11th Edition

ISBN:9781337392938

Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Publisher:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Chapter14: Gene Regulation

Section: Chapter Questions

Problem 13TYU: INTERPRET DATA Develop a simple hypothesis that would explain the behavior of each of the following...

See similar textbooks

Similar questions

Consider a bacterial strain that has a mutant lac repressor that cannot bind the operator. A. What will happen in the presence and absence of lactose? B. Will there be any difference if glucose is present or not? Explain your answer.
a. Would you expect a cell to continue or to stopdividing at a nonpermissive high temperature if itis a temperature-sensitive Ras mutant whose protein product is fixed in the GTP-bound form atnonpermissive temperature?b. What would you expect if you had a temperaturesensitive mutant in which the Ras protein staysin the GDP-bound form at high temperature?
When the amino acid levels in eukaryotic cells are low, general protein synthesis is reduced. Gcn4 translation, however, is increased. A. What would happen under high and low amino acid conditions if only one of the upstream ORFs were deleted from Gcn4? B. What would happen under high and low amino acid conditions if all of the upstream ORFs were deleted from Gcn4?
There is Hyaluronic acid synthesis occuring in Group X Strep and it is controlled by an operon with 3 genes, called hasXYZ. Based on the 3-line diagram model, a. How many ribosome binding sites are there for the protein? b. How many promoters are there for the genes? c. How many start codons are there for the protein? d. How many RNA Polymerase binding locations are there for the genes? e. How many proteins will be fully functional? f. How many mRNA strands are made?
a. Panels G, H, and I show pattters wher fluorescence is detected in the cytosol or internal cellular membranes. Do these results support the hypothesis that the identity of the beta subunit also plays a role in subcellular localization? b.If co-expression of a given alpha subunit caused the pairs in panels G, H, and I to migrate to the plasma membrane, what would that tell you about the process of plasma membrane localization with heterotrimeric G-proteins containing the beta-5 subunit? (This is all the information that is provided!)
You were recently tasked with the responsibility of generating an aptamer that was capable of binding to protein K with high specificity. a) Describe how you would utilize methods such as SELEX to identify aptamer candidates with the desired property. b) Assuming that aptamer binding was dependent on the presence of a bound Mg2+ (no metal binding site on protein K) describe how you would account for this metal binding requirement in your SELEX workflow.
When mRNA was discovered, Francis Crick proposed the Adaptor Hypothesis. He predicted that there would be a set of adaptor molecules which recognized a specific nucleotide sequence on one end and a specific amino acid on the other end. 1A. Is there such a set of adaptor molecules? What are they called? 1B. How do these adaptor molecules recognize specific nucleotide sequences? 1C. How do these adaptor molecules recognize specific amino acids? If they do not recognize specific amino acids, how do specific amino acids become attached to specific adaptor molecules?
The amino acid at the β82 position is in the central cavity that binds 2,3-bisphosphoglycerate in the deoxygenated form of hemoglobin. How would the mutation of Lys to Asn affect the ability to bind to 2,3-BPG? a. It would have no effect. b. It would have decreased 2,3-BPG binding. c. It would have increased 2,3-BPG binding. d. It would have increased 2,3-BPG binding at least two fold.
A recent genome sequencing project for the bacterium Burkholderia mallei has identified a new protein with high similarity to the lysylphosphatidylglycerol flippase enzyme. A short section of the new protein sequence is shown below. TVEVNAPGDVQKALSELQQINDGRLDIRI (a) Are any reverse turns likely to be present? Explain your answer. (b) Are any beta-strands likely to be present? Explain your answer. (c) Are any alpha helices likely to be present? Explain your answer. (d) Is any supersecondary structure likely to be present? Explain your answer. (e) Identify two residues that are likely to be buried in the core of the folded protein. Explain your answer. (f) Identify two residues that are likely to be hydrogen bonded to each other. Explain your answer.
Which of the following domains would you not expect to see in the receptor for BMP4? A. A ligand-binding domain B. A transmembrane domain C. A cytoplasmic domain D. A DNA-binding domain E. All of the above would be seen in the receptor for BMP4
The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by Edman degradation and have the sequence:AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK(a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein.(b) What are the cleavage sites using chymotrypsin?
What is a hydropathy plot, and why is it used?A.A hydropathy plot, is a graph showing the distribution of hydrophobic amino acids along the length of a peptide sequence and is used to predict the regions within a protein most likely to be post-translationally modified with a lipid moiety. B.A hydropathy plot identifies the concentration of water in a cell and is used to predict the type of metabolic reactions performed by the cells. C.A hydropathy plot , is a graph showing the distribution of hydrophillic amino acids along the length of a peptide sequence and is used to predict the regions within a protein most likely to be glycosylated. D.A hydropathy plot, is a graph showing the distribution of hydrophobic amino acids over the length of a paptide sequence, which is used to predict the position of transmembrane domains within a protein.