Below which is false about determining protein three-dimensional structure?OX-ray crystallography requires pure protein samples.X-ray crystallography requires X-ray.Cryo-electron microscopy requires low temperature.O Cryo-electron microscopy requires protein crystals.O Cryo-electron microscopy requires electron beam.

X-ray crystallography is a non-destructive method to determine the crystal information of any pure…

Answered: Below which is false about determining…

Science

Chemistry

Below which is false about determining protein three-dimensional structure?

Chemistry for Engineering Students

4th Edition

ISBN:9781337398909

Author:Lawrence S. Brown, Tom Holme

Publisher:Lawrence S. Brown, Tom Holme

Chapter8: Molecules And Materials

Section: Chapter Questions

Problem 8.69PAE

See similar textbooks

Related questions

Q: Molecules that are nonsuperimposable mirror images of one another are called

A: They are optically active isomers .These molecules have same molecular mass but rotate the plane…

Q: One of the levels of proteins is called tertiary. Name and define two of the categories for tertiary…

A: The tertiary structure of protein is a three dimensional structure of protein. A protein needs to…

Q: 8) Which R group would most likely be found in a hydrophobic area of the tertiary structure of a…

A: Molecule or the major part should be non-polar for a hydrophobic area in a molecule.

Q: Write the structure for the protein Pro-Asn-Tyr-Cys at pH 7.0.

A: Amino acid: An amino acid is an organic molecule and it consists of amine group (NH2), acidic…

Q: What observations led Linus Pauling and his colleaguesto hypothesize that the peptide bond exists as…

A: The structure of protein contains amino acids as the basic monomer unit. These amino acids are…

Q: What color is Alanine in this protein structure?

A: The RasMol 'amino' colour scheme colours amino acids according to traditional amino acid properties.…

Q: 5 ased on molecular weights of purified (no beta-Me) and (beta-Me) sample, which are 97.4 kDa and…

A: Given , molecular weight of (no beta -Me ) purified sample = 97.4 kDa molecular weight of (beta -Me)…

Q: Write the Structure Activity Relationship (SAR) of Nifedipine? Please answer at your own words

A: Nifedipine Used as Calcium channel blocker that used to manage angina ,high blood pressure.

Q: Examine the R groups of two amino acids illustrated below and specify the type of interaction that…

Q: Draw Tryptophan in a peptide bond. Explain all of the bonds using valence bond theory (VBT). Next,…

Q: Describe the function or biological activity of each protein or peptide: (a) collagen; (b)…

A: Collagen: Collagen is a structural protein containing three amino acids. It acts as the glue which…

Q: What is the charge of each amino acid residue in the peptide chain and what is the net charge on the…

A: The peptide KGL contains the following amino acids lysine glycine leucine

Q: Net charge and isoelectric point of an amino acid with an ionizable side group.Consider the net…

A: Hey since you have posted a question with multiple sub-parts, we will solve first three sub-parts…

Q: Would you expect myoglobin to be more or less soluble in water than a protein composed primarily of…

A: Myoglobin is more soluble in water. Because the non-polar amino acid side chains on the surface…

Q: biochemical importance of plasma proteins? (e.g: globulin, abumuin, Fibrinogen)

A: Plasma protein also knows as blood protein serves many important functions:

Q: 1H 19F has a force constant of 966 N m-1. Calculate the frequency of light corresponding to the…

A: In infrared spectroscopy, the infrared radiation interacts with the molecule to give the spectra.…

Q: Make

A: According to the question, molecule C4H11N5 was the side chain of an amino acid, in a protein, we…

Q: Illustrate the lONlZATlON STRUCTURES and determine the isoelectric point (pI) of the given amino…

A: We have to illustrate the lONlZATlON STRUCTURES and determine the isoelectric point (pI) of the…

Q: What amino acid is found at this position: 148 of 4ALD? Explain why this position in your protein is…

A: 4 ALD also known as Human muscle protein. ( FRUCTOSE 1,6 - BIPHOSPHATE ALDOLASE) It has a sequence…

Q: 5 (a) Describe in detail how you will determine the primary structure of protein. (c) You have been…

A: Amino acids are those hydrocarbons that have a central carbon atom which is attached to a carboxylic…

Q: 1. What is the difference between a globular vs. a fibrous protein. 2. When a protein is denatured…

A: 1) Answer - Difference Between Fibrous Protein and Globular Protein Fibrous Protein…

Q: Myoglobin is an example of a protein containing what level of protein structures)? Check all that…

A: Myoglobin is an iron- and oxygen-binding protein found in the skeletal muscle tissue of vertebrates…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this region.…

A: There are two secondary structures: 1. Alpha Helix 2. Beta sheets RRPVVLMAACLRPVVFITYGDGGTYYHWYH…

Q: 2. From the data in table A, what amino acid(s) does gelatin contain?

Q: Define homologous series?

A: The group of organic compounds that can be expressed by the same general formula having the same…

Q: The above amino acid, shown at pH = 7.0 and where every atom (including %3D hydrogens!) is visible,…

A: Amino acids are molecules that combine to form proteins. Amino acids and proteins are the building…

Q: What is the major force responsible for the formation of an a-helix in protein secondary structure?…

A: In this question, we will see which force is responsible for making alpha helix in secondary…

Q: The molecular weight of alanine at pH = 7.0 is 89.1 g/mol. Calculate the molecular weight of the…

Q: NH, но -CH, H,C- CH,OH носн,

A: The explanation is given below-

Q: Question posted as attachment

A: The bond angle of a compound can be determined from the hybridization of a molecule. Here, the angle…

Q: dentity the predominate attractive force responsible for the proteins tertiary structure at the…

Q: The diagram shows which level of structure of a protein? hydrogen bond CH, CH H.C CH, hydrophobic…

Q: Which peptides is more likely to take up on alpha-helical structure? Explain. Top:…

A: The alpha-helical structure is the right-hand helix conformation present in the secondary structure…

Q: The protein in 1ZAA is an example of a zinc finger protein, whose three successive zinc finger…

A: Yes,in zinc finger protein the Zn(II) attached with 2 histidine(alpha-helix) and 2…

Q: Based on the structural properties of 7EHE, how resistant (or sensitive) would your protein be to…

A: Protein denaturation alters the normal alpha-helix and beta sheets of a protein that uncoils the…

Q: Which of the following statements is/are TRUE for globular proteins? O structural role regular amino…

A: Globular proteins, are always soluble in water and often have a spherical or round shape. As in all…

Q: What are the three dimensional structures of (R) - 2-aminopentane and (S) - 2-aminopropanoic acid…

A: In most of the carbon compound, carbon is sp3 hybridised. The sp3 carbon atom is a non plannar atom…

Q: Which of the 20 amino acids feature(s) two chiral centers? On this question you are allowed to…

A: “Since you have asked multiple question, we will solve the first question for you. If you want any…

Q: peptide has the sequence

A: peptide sequence is:…

Q: Identify whether it is HYDROPHILIC OR HYDROPHOBIC Refer to the peptide image below. * NH CH, CH CH3…

A: The question is based on the concept of polypeptides. We have to identify the nature of the given…

Q: Explain about cysteine residues. How many cysteine residues a α-Keratins has ?

A: 7%–20% of the total amino acid residues. (Hearle 2000).

Q: Why would a protein likely remain soluble at pH conditions either above or below the protein’s pI,…

A: The solution is given below -

Q: (a) Describe in detail how you will determine the primary structure of protein. You have been given…

A: (a) Primary structure of protein The primary structure of a protein is generally referred to the…

Q: The secondary structure of a protein is the Multiple Choice Ospecific order of amino acids in the…

A: Secondary structure refers to regular, recurring arrangements in space of adjacent amino acid…

Q: Do the identities of R1 and R2 in phosphatidic acid affect the configuration of the asymmetric…

A: Lipids:Lipids are organic compounds found in living organisms that are soluble in nonpolar…

Q: Which of the following is an example of tertiary protein structure: Group of answer choices a.…

A: Proteins are polymers of α-amino acids. They are regarded as polypeptides consisting of amide (…

Q: Almost all proteins are composed from a set of about _____ amino acids. a. 4 b. 10 c. 20 d. 50

A: Hello. Since you have posted multiple questions and not specified which question needs to be solved,…

Q: Given a sequence of amino acids explain the type of secondary structure you will expect the protein…

A: Amino acids are the biomolecules that contain both amino and carboxylic acid groups. Each amino acid…

Q: For which of the following is the hydrophobic effect the main explanation. A) micelle formation by…

A: Hydrophobic effect can be defined as the tendency of non -polar substances to be in a fear of…

Concept explainers

Spectroanalytical Methods

Spectroanalytical methods measure the wavelength and intensity of radiations that are either emitted or absorbed by a molecular or atomic species. These methods are useful for evaluating the electronic or atomic arrangement of the molecules of a given analyte.

Question

Below which is false about determining protein three-dimensional structure?
OX-ray crystallography requires pure protein samples.
X-ray crystallography requires X-ray.
Cryo-electron microscopy requires low temperature.
O Cryo-electron microscopy requires protein crystals.
O Cryo-electron microscopy requires electron beam.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

Does FeSe have a larger band gap than ZnSe?
PTFE polymer has a very high crystallinity among known commercial polymers. write down the reasons
What is the most prominent IMFA/s present when water forms beaded droplets on a waxy surface?
Water rises in capillar tubes because A. cohesion is greater than adhesion B. adhesion is greater than cohesion C. cohesion and adhesion are the same D. none of the above
The heat of fusion of a sample of (polyethylene oxide) (PEO) was determined by DSC and turned out to be 6.0 J mol – 1. Considering that the heat of fusion of 100% crystalline PEO is 8.29 kJ mol – 1, estimate the degree of crystallinity of the sample.
True or False 1. The highest polarizability and expected to have the highest boiling point is Cl2 among H2, N2, & O2 2. Considering (simple cubic, face-centered cubic, hexagonal closed packed) structures, the least efficient packing is the simple cubic. 3. In the electron sea model, the valence electrons in metals are assumed to be fixed in the lattice points.
a tetragonal crystal, unit cell a =4.5Å, c = 6Å. Evaluate the Bragg angle, q, for the (222) reflection please solve by details
What is the coordination number for Pd in cisplatin? [Pd(NH3)2Cl2]
Poisson’s ratio for polyethene is 0.45. What change in volume takes place when a cube of polyethene of volume 1.0 cm3 is subjected to a uniaxial stress that produces a strain of 1.0 per cent?
The repeat unit in polystyrene coffee cup has C6H5CHCH2. If the molar mass of the polymer is 3.5x10^5. What is the degree of polymerization? C=12.01 g/mol H=1.008 g/mol
TRUE OR FALSE (If false then write the correct word in Bold Word to make it correct) and justify the answer. 1. Is Buckminsterfullerene A POLYMORPH of graphene? 2. Does schottky defects induce TENSILE forces in neighboring atoms? 3. Is it true that silicate glasses are a POLYCRYSTALLINE material?
Why is the average molar mass of a polymer sample dif-ferent from the molar mass of an individual chain?