Decide whether each of the following statements is true about ornithine carbamoyltransferase. It's a small molecule, with a molecular weight around 50 mol It's made by a ribosome out of amino acids. It's a substrate, and ornithine is its superstrate. It has no effect on the stability of ornithine, that is, it does not change the free energy of ornithine. O true false true false Otrue false O true false
Q: For the reaction 2NH3(g) 3H₂(g) + N₂(g) the equilibrium concentrations were found to be [NH3] =…
A: The equilibrium constant of a chemical reaction is the ratio of the product of the active masses of…
Q: Explain why unfolding or aggregation may occur using changes in entropy and enthalpy of the protein…
A: Adding a small amount of salt into a protein solution can increase the solubility of the protein in…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: ou have been researching two additional methyltransferase enzymes that catalyze the same reaction.…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Collagen is composed of the collagen triple helix containing 1042 amino acids, How long is the…
A: Structure of Collagen: Collagen is a major structural protein in the extracellular matrix. It is…
Q: Please provide explanations and work for each part of the question. If able to keep the same format…
A: Protein structure is a fundamental concept within biochemistry, encompassing the hierarchical…
Q: You need to prepare an acetate buffer of pH 5.54 from a 0.672 M acetic acid solution and a 2.90 M…
A: To prepare an acetate buffer at pH 5.54 using acetic acid (CH3COOH) and potassium hydroxide (KOH),…
Q: A researcher has synthesized two peptides and needs to confirm whether the peptides were synthesized…
A: Tandem MS(also called MS/MS) and ElectroSpray Ionization-Time Of Flight Mass Spectroscopy…
Q: . Make a series (at least 3) of drawings to show the three dehydration synthesis reactions that take…
A: Since you have posted multiple questions, we will provide the solution only to the first question as…
Q: In detail ,compare between alpha helices and beta sheets?
A: Proteins are the biomolecules that show great variation in their structural organisation. They are…
Q: Illustrate the ATP hydrolysis reaction, its regeneration and the AG for both reactions. Show where…
A: ATP is the energy currency of the cell. It is simply an adenosine molecule bonded to a triphosphate.…
Q: You're examining an amino acid at position 3 in an alpha helix. Without knowing the specific amino…
A: Amino acids are the building blocks of proteins and play essential roles in various biological…
Q: Consider beta-sheet comprised of twelve amino acid residues (two strands of six residues each). How…
A: Proteins are the macro molecules that show great diversity in their structure. They show four levels…
Q: 22. If 75 mls of 0.02 M HCI is added to 425 mls of 0.5 M glycine buffer at pH 10.4, what is the…
A: Here given that, there is 425 mL of 0.5M glycine buffer at pH 10.4425 mL is equal to 0.425 L…
Q: Beta-sheets are roughly planar structures, in which the backbone hydrogen bonding pattern defines…
A: Beta sheet is the secondary structure of a protein that is formed by the hydrogen bonds between the…
Q: Please draw the structure of the amino acid Histidine at each ionization state and please also give…
A: a) Histidine has three ionizable groups and equilibrium equations for its three ionizations are…
Q: Carbon dioxide is dissolved in blood (pH 7.5) to form a mixture of carbonic acid and bicarbonate.…
A: pH=pKa+log( A−/HA) Given the pKa valuespH=6.3+log(HCO3−/H2CO3)Since we're neglecting free CO2, we'll…
Q: Label the structures of the prokaryotic cell. Not all terms will be used. H₂ DESENTAS Answer Bank…
A: Prokaryotic cells can be defined as single-celled organisms. They are known to belong to the Archaea…
Q: A researcher isolates a new protein and finds that it contains 0.755% serine by weight upon amino…
A: A peptide is a short chain of amino acid residues linked together via a peptide bond. The peptide…
Q: Modify methionine to show its zwitterion form.
A: Here an amino acid "Methionine" is given which has following structure:-
Q: Many reactions in metabolism are thermodynamically unfavorable (ie-the reaction DOES NOT favor the…
A: The thermodynamically unfavorable reaction where ∆G°>0 is driven in metabolism by coupling with…
Q: The turnover number is defined as the maximum number of substrate molecules that can be converted…
A: An essential parameter in enzymology that evaluates an enzyme's catalytic effectiveness is the…
Q: Draw the structure of lysine,arginine, and Cysteine in the protonation state that would predominate…
A: There are four classes of biological macromolecules. They are proteins, nucleic acids, carbohydrates…
Q: Concept map: construct a map of gas transport using the following terms. alveoli, arterial blood,…
A: Q.Ans:- These all terms belong to a single physiology known as Respiration.Respiration is a term…
Q: The phosphoryl group transfer potentials for glucose-1-phosphate and glucose-6-phosphate are -20.9…
A: Details
Q: Match each error with its consequence for protein purification by column chromatography. Incorrect…
A: Column chromatography is a separation technique that uses a stationary phase and a mobile phase to…
Q: The amino acid at the β82 position is in the central cavity that binds 2,3-bisphosphoglycerate in…
A: Asparagine is a neutral amino acid while lysine is positively charged amino acid. Lysine being in…
Q: You are given a pure protein sample to characterize and provided the following information: Its…
A: 1(A)Beer-Lambert Law is often used in spectrophotometry to quantitatively analyze the concentration…
Q: A diploid organism with a 45,000-kb haploid genome contains 21% G residues. Calculate the number of…
A: According to Chargaff's rules, DNA from each cell of any organism should contain a 1:1 ratio (base…
Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…
A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…
Q: In a sequence of amino acids, a non-polar amino acid is mutated into a polar charged amino acid.…
A: Protein or a polypeptide chain is made up of amino acids linked together by peptide bonds. Protein…
Q: Identify the predominant intermolecular forces in each of the given substances. Electrostatic…
A: Ionic interaction: it can be defined as the electrostatic interaction between oppositely charged…
Q: Discussing the Data - Class Average vs Group 9. Use the % change my group for the unknown a. Square…
A: The following worksheet contains so many questions and many of them are solved. Those unsolved are…
Q: Complete the data missing from the table, which shows assay data from the purification protocol of a…
A: A protein purification assay will include multiple protein purification techniques, conducted one…
Q: Classify each peptide chain as part of a parallel β sheet, part of an antiparallel β sheet, either…
A: Beta-sheets are one of the most common secondary structures seen within proteins. Several…
Q: Show the calculation for the preparation of 0.01%, 0.001%, 0.0001%, 0.00001% standard DNA solutions…
A: A liquid combination containing DNA molecules is called a DNA solution. It is frequently employed in…
Q: An intermediate folding stage seen in protein denaturation or renaturation is called : a) domain b)…
A: An intermediate folding stage seen in protein denaturation or renaturation is called :and option :a)…
Q: Calculate either [H3O+] or [OH-] for each of the solutions at 25 °C. Solution A: [OH¯] = 1.43 × 10¯7…
A: To calculate [H3O+] and [OH-] for each of the solutions, we can use the equation for the ion product…
Q: For a particular reaction, AH = -16.1 kJ/mol and AS° = −21.8 J/(mol·K). Assuming these values change…
A: To determine the temperature at which the reaction changes from nonspontaneous to spontaneous in the…
Q: Substrate concentration, [S], has units of micromolar, µM. Enzyme velocity, V₁, has units of…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Depicted above are the Ramachandran plots for Glycine and Alanine. Why do acceptable values for…
A: Peptide conformations are restricted by the dihedral angles phi and psi. The peptide bond has a…
Q: Explain the chemical structure of ATP. Why is it considered to be a modified nucleotide?
A: Adenosine triphosphate (ATP) is an important molecule and is the source of energy for use, storage…
Q: Energy Conversion Problem 1. a) Influence of concentration on the free energy change. In frog…
A: For the chemical reaction:aA + bB -> cC + dDThe reaction quotient Q is calculated as:Q = ([C]^c *…
Q: Select All True Statements as It Relates to the Structure Below. CH₂OH HOH2C EXE HO OH OH Г The…
A: The Compound Formed is the Result of a Reaction Between Glycerol and Amino Acid. Glycerol (a polyol…
Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: Select the choice that best describes the stereochemistry of the following amino acid, and rank the…
A: Cysteine is one of the 20 standard amino acids that serve as the building blocks of proteins. It is…
Q: What characteristics determine the position of a protein on an IPG strip at the end of isoelectric…
A: Isoelectric focussing is a technique used for the separation of biomolecules, particularly proteins,…
Q: Identify the kind of chemical catalysis and then identify which of the given amino acids can act as…
A: Enzymes catalyze reactions using various types of mechanisms. Some of the most observed mechanisms…
Q: Enzymes are important molecules in biochemistry that catalyze reactions. The energy diagram…
A: There are four types of biological macromolecule: proteins, nucleic acids, lipids and…
Q: Mixtures of amino acids can be analyzed by first separating the mixture into its components through…
A: At a pH of 7, the side chain of some of the amino acids will be positively charged, some will be…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps
- Using the biosynthesis of aminolevulinate (ALA) as an example, describe at least two techniques that can be used to elucidate detail of a biosynthetic pathway. Please keep brief - 5 sentences/dot points max.This image is showing the conformations of ubiquitin superimposed. What do the structures in this figure tell us about the dynamics of enzymes? Discuss the limitations of crystal structures in the analysis of proteins. What are the benefits? What are the advantages of NMR structures?Why is the reaction rate low at pH7? Be specific and say something about the enzyme structure at the molecular level!
- Modified TRUE or FALSE. Write the word TRUE if the statement is correct. If the statement is false, write the incorrect underlined word/s and indicate the correct word/s to make the statement true. Extreme temperatures and pH can cause permanent disruption of the protein primary structure(s) of enzymes that leads to loss of active site shape, loss of binding efficiency and activity.Question:- Based on the figure below, predict what peptide bond could be the substrate of each protease(The bond marked in blue is where hydrolysis occurs, choose 2 peptides per protease type) Chymotrypsin:_________ Trypsin:_________ Elastase:_________ 1. SR−SG 2. SF−SG 3. SK−SG 4. SA−SG 5. SV−SG 6. SM−SGFrom the oligopeptide below, write completely the amino acids and/or peptide fragments that resulted from the reaction of elastase. The amino acids and residues should be represented by the three-letter abbreviation.
- Give typing answer with explanation and conclusion On paper draw a dipeptide, clearly showing the peptide bond joining the two amino acids together. If the two amino acids are valine and threonine, predict the overall charge of the dipeptide at pH 7. Do not forget to consider the amino (N-terminal) and carboxy (C-terminal) of the dipeptide, as well as the R groups. Select one: a. +2 b. -2 c. 0 d. -1 e. +1Chart is Given for you: Below is a chart of values for actual enzymes. Enzyme Km (M) kcat (1/s)Chymotrypsin 1.5 × 10^−2 0.14Pepsin 3.0 × 10^−4 0.5Tyrosyl-tRNA synthetase 9.0 × 10^−4 7.6Ribonuclease 7.9 × 10^−3 7.9 × 10^2Carbonic anhydrase 2.6 × 10^−2 4.0 × 10^5Fumarase 5.0 × 10^−6 8.0 × 10^2 Assume the enzyme concentration is equal across all samples (and is equal to 1). (Answer a and b only)a. Which enzyme will have the highest V0 at very high substrate concentrations? (1 M). Why? b. Which will have the highest V0 at very low substrate concentrations (5.0 × 10^−12). Why?Compare and contrast lactose intolerance with galactosemia.(Hint: Make a table.)
- From the oligopeptide below, write completely the amino acids and/or peptide fragments that resulted from the reaction of chymotrypsin. The amino acids and residues should be represented by the three-letter abbreviation.Serine protease enzyme mutation To show differences in the effect of the nucleophilic attack of the carbonyl group (C=O) of peptide bond between the catalytic triad of serine, histidine and aspartic acid, and another catalytic triad contains alanine, histidine and aspartic acid Provide/ draw an example of catalytic mechanism with catalytic triad contains alanine, histidine and aspartic Please answer completely will give rating surelyBIOMOLECULES - Please answer the questions properly. - Multiple choice 1. Chymotrypsin is a digestive enzyme that breaks down proteins. From the following attributes, which one does not characterize chymotrypsin? A. A thiol nucleophile B. Performs proteolysis C. A tetrahedral intermediate D. A catalytic triad of serine, histidine, and aspartate 2. Evaluate the secondary structure of proteins. Which of the following differentiates alpha structures to those beta structures? ? A. alpha structures are helices and beta structures are pleated sheets B. alpha structures are primary and beta structures are secondary C. alpha structures are parallel and beta structures are antiparallel D. alpha structures are L and beta structures are D