Make a figure that includes the hydropathy profile analysis, the TMHMM analysis and the TOPCONS analysis of AlaE attached. Describe the purpose of these analyses, how they work, and what your analyses suggest with regards to the topology of AlaE.
Q: 1. The first step in the payoff phase of glycolysis is catalyzed by the enzyme glyceraldehyde…
A: Gluconeogenesis is the metabolic pathway by which glucose is synthesised from the sources like…
Q: Experimental results describing a protein's amino acid composition are useful for estimating the…
A: Proteins are high molecular weight polymers of amino acid residues linked together via peptide…
Q: Question 2
A: The objective of the question is to understand the function of the metaphase checkpoint in the cell…
Q: Draw the amino acid below in its most protonated form, any intermediately protonated forms, and its…
A: pH = 1/Log [H+] If [H+] concentration in a solution is high, pH will be low and the solution is…
Q: Answer the following questions with regards to DNA replication: 1. In what direction does DNA…
A: DNA replication is the process of duplication of DNA by using the parent strands as template strands…
Q: Question 6 Listen In cats, Short Hair (S) is dominant to long hair, Black fur (C) is dominant to…
A: The objective of this question is to determine the probability of a specific phenotype in the…
Q: Draw a set of free energy diagrams that show the differences between a spontaneous reaction that…
A: Free energy diagrams have free energy (G) in Y-axis and reaction coordinate in X-axis. These can…
Q: How do glucagon and epinephrine affect glycogen in the liver? They increase both glycogen breakdown…
A: Glucagon is a polypeptide hormone secreted by the alpha cells of Iselets of pancreas. Glucagon is…
Q: Draw the structure of Arg - Lys - Ser - Trp at ph 7.4
A: The proteins are biological macromolecules that are composed of twenty naturally occurring amino…
Q: What is the purpose behind the introduction of the triazole ring in this sedative-hypnotic agent? To…
A: The figure in question is the structure of the benzodiazepine called alprazolam. Benzodiazepines are…
Q: Question 1: The standard reduction potential for the the cytochrome c Fe3+/Fe2+ redox couple and for…
A: Biological oxidation-reduction reactions involve the transfer of electrons from one biomolecule,…
Q: what happens in a normal patient when they consume a large amount of glucose?
A: Glucose is the primary fuel for a living cell. Cellular respiration (glycolysis + citric acid cycle…
Q: Create a concept map to demonstrate the relationships between carbohydrate, protein and lipid…
A: Catabolism is the breakdown of large molecules into smaller ones. This is often undertaken to…
Q: Explain the biosynthesis of acetylcholine.
A: Acetyl choline is an amino alcohol which consists of a quaternary amino group, ethylene bridge and…
Q: what metabolic pathways are more likely to be active during: a) fasting, b) overnight fast) and c)…
A: Intermediary metabolism, also known as metabolic pathways, is the intricate network of chemical…
Q: how to use valine in a 2 chemical equation involved in this experiment using the scheme below .
A: A method for separating and analyzing amino acids in a mixture is HPLC Ion Exchange Chromatography.…
Q: Fatty Acids-Draw out one fatty acid from the list given in class. Hydrocarbon chain atoms do not…
A: Fatty acids are carboxylic acids and structural components of lipids. Fatty acids are generally…
Q: Determine the fraction of Vmax that would be obtained when the substrate concentration, [S], is…
A: Michaelis-Menten equation:Leonor Michaelis and Maude Menten created a simple model that accounts for…
Q: Choose the correct structure for thiamine hydrochloride at pH 3. H3C H3C NH₂ NH₂ CI- A CI- с CH3 CH3…
A: The relationship between pH and pKa is described by the Henderson-Hasselbalch equation:pH = pKa +…
Q: Please draw out mechanism The formation of fructose 1, 6- biphophste from dihydroxyacetome phospahte…
A: Glycolysis:The metabolic process known as glycolysis, which in most organisms takes place in the…
Q: Question 10 Listen Donna is heterozygous for both hemophilia (a sex linked recessive trait) and…
A: The objective of this question is to determine the probability of Donna and Michael's sons…
Q: Which of the following is not a carbohydrate? a. C3H603 Ob. C50H100050 c. C6H806 d. C4H804
A: Definition of Carbohydrates: Carbohydrates are organic compounds made up of carbon, hydrogen, and…
Q: imagine that you are running a sample on a TLC plate that is comprised of aspartate and isoleucine.…
A: The working principle of thin-layer chromatography is the same as column chromatography.A small…
Q: Describe the amino acid composition in terms of the general characteristics and comment on what the…
A: Proteins are made up of around 20 standard and a few non-standard amino acids. Depending on the…
Q: a. Write the structure of a-D-fructose.
A: Since you have posted multiple questions, we will provide the solution only to the first question as…
Q: 7. Do Km and Vmax get affected by available substrate concentration? Explain.
A: Enzymes are high molecular-weight protein molecules that catalyse biochemical reactions. The…
Q: An individu with chronic hypoglycemia was suspected of having a defect in one of the enzymes unique…
A: Glycolysis is the conversion of glucose to 2 pyruvate molecules. Gluconeogenesis is the conversion…
Q: A plot showing the % of denautration as a function of temperature for a melting point of a DNA…
A: Melting point of DNA can also be referred to as melting temperature of DNA. It is the temperature at…
Q: High [ATP] slows glycolysis and speeds of gluconeogenesis because (check all that apply): Pyruvate…
A: ATP is the energy currency of the cell i.e. the cell mostly uses ATP as the source of energy for…
Q: Dihybrid Cross Problem 2: When does a phenotype ratio of 9:3:3:1 occur? A phenotype ratio of 9:3:3:1…
A: The objective of the question is to identify the correct condition under which a phenotype ratio of…
Q: Sketch a typical enzyme kinetic curve of [S] vs. V. The maximum [S] should be about four times the…
A: In a typical enzyme kinetic curve, the substrate concentration, [S] is plotted along the x-axis and…
Q: You start by conducting a binding experiment using purified Slugase enzyme at a concentration of 100…
A: By plotting a saturation curve for protein-ligand binding interaction, we will be able to estimate…
Q: Which of the sugars below are diastereomers of compound I? CHO H+ OH H-+OH H+OH CH₂OH I CHO H-OH…
A: Stereoisomers are the type of isomers in which the chemical formula of the molecules as well as the…
Q: Why can’t we see the double helix structure of DNA of strawberry and kiwi?
A: The question is asking why we can't visually observe the double helix structure of DNA in…
Q: What is the target for the following compound? O Muscarinic receptor O Acetylcholinesterase enzyme O…
A: Acetylcholine is a neurotransmitter. Many enzymes and proteins involved in the metabolism and…
Q: 5. What is the binuclear center of cytochrome oxidase? How does it function in the reduction of O₂?
A: The binuclear center of cytochrome oxidase is the active site of this key enzyme in the electron…
Q: In what way are carbon-based compounds like children's Tinker Toys or Lego blocks? Give a few…
A: Carbon-based compounds are often compared to children's Tinker Toys or Lego blocks because carbon…
Q: Listen Colorblindness is a recessive sex linked trait. Diane is not colorblind, but she has a color…
A: Colorblindness is a recessive sex-linked trait, meaning it is carried on the X chromosome. Since…
Q: If the rate of amino acid replacement for the cytochrome c protein is 9.0E-10 replacements per amino…
A: The rate at which amino acids are changed or replaced over time in a protein sequence. the speed at…
Q: Structures PLEASE DRAW OUT THE FATTY ACIDS - Hydrocarbon chain atoms DO NOT need to be labeled,…
A: A fatty acid is a carboxylic acid with an aliphatic chain. These chains are either saturated or…
Q: 2. Selective synthesis of the tetrapeptide Ala-Val-Gly-Leu a. Work backward from Structure K to fill…
A: Peptides can be synthesized chemically. For this we use various reagents like Boc (also called…
Q: - Why Michalis plot is not used, instead double reciprocal plot is used to determine KM and Vmax?
A: The Michaelis-Menten plot and the double reciprocal (Lineweaver-Burk) plot are two common graphical…
Q: Why is the NAD+/NADH pairing so effective in biochemical redox reactions? A The reactions occur…
A: NAD+ /NADH pairing means the interconversion between nicotinamide adenine dinucleotide (NAD+) and…
Q: A portion of the sequence from the DNA coding strand of the chick ovalbumin gene is shown. Determine…
A: Transcription is the process during which the DNA double helix unwinds and the RNA polymerase enzyme…
Q: An engineered ligand binds its target with 5 nM affinity at high pH. However, protonation of a…
A: An engineered ligand (L) binds to a target protein (T) to form a ligand:target complex (LT). The…
Q: 1. H₂N a. Draw the peptide sequence, including stereochemistry (wedges and dashes) for Glu-Cys- Gly.…
A: Stereochemistry refers to the illustration of the arrangement or connectivity of atoms to a chiral…
Q: Question: Estimate the pl of the tripeptide ? Step 1: Determine what can be protonated/deprotonated…
A: There are four classes of biological macromolecules: proteins, nucleic acids, lipids and…
Q: The carboxylation of acetyl CoA to synthesize malonyl CoA by acetyl CoA carboxylase requires…
A: One of the B vitamins is biotin, sometimes referred to as vitamin H or B7. Both in humans and other…
Q: Draw all the Amino Acids- All 19 – Draw out the Peptide backbone atoms and draw out the side chains…
A: Amino acids are biomolecules that have a hydrogen atom, an amino group, a carboxyl group and a…
Q: Given below is the mRNA sequence that encodes the amino acids of a protein. Based on the mRNA…
A: ● To figure out the protein sequence from mRNA sequence we need to use a codon table where 3 bases…
Make a figure that includes the hydropathy profile analysis, the TMHMM analysis and the TOPCONS analysis of AlaE attached.
Describe the purpose of these analyses, how they work, and what your analyses suggest with regards to the topology of AlaE.
Step by step
Solved in 3 steps with 14 images
- Calmodulin dependent kinase 1 protein contains 14 tyrosine's 4 tryptophans and 6 phenylalanines the molar extinction coefficient of this protein is approximately 39,200 abs m^-1 cm^-1 not enough information 11,200 abs m^-1 cm^-1 83,200 abs m^-1 cm^-1Understanding the Relevance of Chaperones in Protein Folding Protein molecules, like all molecules, can be characterized in terms of general properties such as size, shape, charge, solubility/hydrophobicity. Consider the influence of each of these general features on the likelihood of whether folding of a particular protein will require chaperone assistance or not. Be specific regarding just Hsp7O chaperones or Hsp7O chaperones and Hsp60 chaperonins.Answer for each 1, 2, 3, 4 and 5 labelled in the attached image: a)What is this molecule? b)What superfamily does it belong to? c)Which number points to the peptide binding domain? Thank you!
- A C-terminal KDEL tetrapeptide was identified by “sequence gazing” as a possiblesignal for keeping resident ER proteins in the ER. This idea is now described in yourtextbook as established fact. What types of experiments do you think were performedto confirm that KDEL serves as an ER localization signal?Sars-CoV-2 spike protein: VGIYLQKTSDHRPEFALAMN What is its isoelectric point of this peptide?main binding pocket inside the GLP-1 receptor and the critical residues found in GLP-1 particularly in its N-terminus. what are the amino acids found particularly in its N terminus
- Which statements are true? Explain why or why not.1 Each strand in a β sheet is a helix with two aminoacids per turn.2 Intrinsically disordered regions of proteins can beidentified using bioinformatic methods to search genes forencoded amino acid sequences that possess high hydro-phobicity and low net charge.3 Loops of polypeptide that protrude from the sur-face of a protein often form the binding sites for other mol-ecules.4 An enzyme reaches a maximum rate at high sub-strate concentration because it has a fixed number ofactive sites where substrate binds.5 Higher concentrations of enzyme give rise to ahigher turnover number.6 Enzymes that undergo cooperative allosteric tran-sitions invariably consist of symmetric assemblies of mul-tiple subunits.7 Continual addition and removal of phosphatesby protein kinases and protein phosphatases is wastefulof energy—since their combined action consumes ATP—but it is a necessary consequence of effective regulation byphosphorylation.These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV..You have isolated a new protein called STICKY. You can predict from comparisons with other known proteins thatSTICKY contains a bHLH domain.Predict the function of STICKY and rationale for the importance of these domains in STICKY function.. ..
- Both hsp60-like and hsp70 molecular chaperonesshare an affinity for exposed hydrophobic patches on pro-teins, using them as indicators of incomplete folding. Whydo you suppose hydrophobic patches serve as critical sig-nals for the folding status of a protein?Problem: From the following information determine the amino acid sequence of a peptide. N-terminal Edman gives PTH-Alanine C terminal carboxypeptidase treatment, no observable reaction Trypsin cleavage gives three products Arg Peptide containing Ala, Lys Peptide containing Asp, Met, Phe, Pro Mild Chymotrypsin cleavage gives 2 peptides Peptide containing Asp, Pro Peptide containing Ala, Arg, Lys, Met, Phe CNBr cleavage gives 2 peptides Peptide containing Ala, Arg, Lys and homoserine Peptide containing Asp, Phe, Pro You must supply the answer as the 3-letter amino acid sequence from N-terminus to C-terminus in the form (you must use dashes, not spaces between the amino acids) Met-Thr-Glu-TrpJack is applyng to Gate's foundation for a grant to make a high affinity, humanized monoclonal antibody that could neutralize venom, a 7 kDa protein of 62 amino aicds, from cobra snakes. He argues that many people in tropical areas are bitten by the poisonous snakes and may need injection of this life-saving anitbody more than once. His friend has successfully purified the 7kDA venom protein expressed in E. coli in a large quantity and will give him whatever he needs for his project. Assume that he recovers four anti-venom monoclonal antibodies. What is the method he can use to identify the one with the highest affinity to the venom?