What type of mutation occurred to produce the abnormal sequence (nonsense or missense)? Explain your answer. Normal sequence:DNA:GGACCUprlineCTCGAGglutamic acidСТСGAGglutamic acidMRNA:Amino Acids:Abnormal sequence:DNA:GGAСТСGAGglutamic acidCÁCCCUGUGMRNA:Amino Acids:prolinevaline

Name: What type of mutation occurred to produce the abnormal sequence (nonse
Uploaded: 2024-03-20T06:42:41.000Z
Channel: Bartleby
Description: What type of mutation occurred to produce the abnormal sequence (nonsense or missense)? Explain your answer. Normal sequence:DNA:GGACCUprlineCTCGAGglutamic acidСТСGAGglutamic acidMRNA:Amino Acids:Abnormal sequence:DNA:GGAСТСGAGglutamic acidCÁCCCUGUG

A mutation is a change in a DNA sequence.

Answered: What type of mutation occurred to…

Science

Biology

What type of mutation occurred to produce the abnormal sequence (nonsense or missense)? Explain your answer.

Human Biology (MindTap Course List)

11th Edition

ISBN:9781305112100

Author:Cecie Starr, Beverly McMillan

Publisher:Cecie Starr, Beverly McMillan

Chapter21: Dna, Genes, And Biotechnology

Section: Chapter Questions

Problem 6SQ

See similar textbooks

Similar questions

DNA: AGA ACA TAA TAC CTC TTA ACA CTC TAA AGA CCA GCA CTC CGA TGA ACT GGA GAC mRNA;Protein;
Sequence: AAA UGG CAA Is the sequence RNA or DNA? How do you know? Question 1 options: You can't tell until a protein is made. It is RNA because it contains uracil. It is a protein because it contains alanine. It is DNA because it contains adenine.
if the DNA sequence if: TTACGTA, the complementary RNA sequence will be following A. AATCGAT B. AATGCTA C.AATGCAT D.AAUGCAU
If the DNA sequence is ATG-CGT, the mRNA codons are ___. ATG-CGT UAC-GCA GUA-CGU AUG-CGU UAG-CGU
State if the DNA is written 5' to 3' or 3' to 5' Transcribe the sequence. Include the 5' and 3' Translate the sequence (codon chart included) +1 TAGTCCAAAGGTTTACGTAAATGGGATGTCGAAATTGACTAGATCA
Transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain, identifying the codons, anticodons, and amino acid sequence. DNA: C G A T A C A A T G G A C C C G G T A T G C G A T A T C C mRNA: Codon: Anitcodon: Amino Acids:
__________ are composed of a single linear (unbranching) chain of covalently bound amino acids. Select one or more: a. peptides b. triglycerides c. codons d. nucleotides e. glycosides.
If the sequence of one strand of DNA is CTCGGA, the sequence of the complementary strand will be Group of answer choices TCTAGG GGACTC GAGCCT CTCGGA TCCGAG
Choose the option that goes with the blank. The parentheses after the blank are the choices. ____________ (Introns, Anticodons, Codons) are three nucleotide units of information in mRNA that often specify a particular amino acid. They correspond to complementary sets of three nucleotides on tRNA called ___________ (introns, anticodons, codons).
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
Which of the following choices best match the blank? Three-nucleotide segments of RNA called _________ encode for specific amino acids. Their order in mRNA determines the order of amino acids, which are connected together to make the protein. The amino acid translation chart shows the 64 possible three-nucleotide combinations and the amino acids they code for in most organisms. A. codonsB. chromosomesC. genes
transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain, identifying the codons, anticodons, and amino acid sequence. DNA: T T T A C G G C C A T C A G G C A A T A C T G G mRNA: Codon: Anitcodon: