Which of the following proteins is a combinatorial transcriptional regulator in Drosophila that affects the differentiation of multiple cell types? O the glucocorticoid receptor O MyoD O Ey O Muts O maintenance methyltransferase

Which of the following proteins is a combinatorial transcriptional regulator in Drosophila that affects the differentiation of multiple cell types? O the glucocorticoid receptor O MyoD O Ey O Muts O maintenance methyltransferase

Name: Which of the following proteins is a combinatorialtranscriptional reg
Uploaded: 2024-03-20T06:42:41.000Z
Channel: Bartleby
Description: Which of the following proteins is a combinatorialtranscriptional regulator in Drosophila that affects thedifferentiation of multiple cell types?O the glucocorticoid receptorO MyoDO EyO MutsO maintenance methyltransferase

Biology: The Unity and Diversity of Life (MindTap Course List)

14th Edition

ISBN:9781305073951

Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr

Publisher:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr

Chapter43: Animal Behavior

Section: Chapter Questions

Problem 12SQ

See similar textbooks

Similar questions

Presence of proximal and distal promoters in Drosophila melanogaster for alcohol dehydrogenase. Is it: Pre-transcriptional control Transcriptional control Translational control Post-translational control
I. The retinoic acid receptor (RAR) is a transcription factor that is similar to steroid hormone receptors. Thesubstance (ligand) that binds to this receptor is retinoicacid. One of the genes whose transcription is activatedby retinoic acid binding to the receptor is myoD. Thediagram that follows shows a schematic view of theRAR proteins produced by genes into which one oftwo different 12-base double-stranded oligonucleotides had been inserted in the ORF. The insertion site(a–m) associated with each mutant protein is indicatedwith the appropriate letter on the polypeptide map.For constructs encoding proteins a–e, oligonucleotide 1(5′ TTAATTAATTAA 3′ read off either strand) wasinserted into the RAR gene. For constructs encoding proteins f–m, oligonucleotide 2 (5′ CCGGCCGGCCGG 3′)was inserted into the gene.NH2 f g h i j k l m COOHa b c d eThe wild-type RAR protein can both bind DNA and activate transcription weakly in the absence of retinoic acid(RA) and strongly in RA’s presence. Each…
Put the following steps in the correct orderedsequence.a. kinase cascadeb. activation of a transcription factorc. hormone binds transmembrane receptord. expression of target genes in the nucleuse. Ras molecular switch
The Wnt planar polarity signaling pathway nor-mally ensures that each wing cell in Drosophila has a sin-gle hair. Overexpression of the Frizzled gene from a heat-shock promoter (hs-Fz) causes multiple hairs to grow frommany cells (Figure Q15–5A). This phenotype is suppressedif hs-Fz is combined with a heterozygous deletion (DshΔ)of the Dishevelled gene (Figure Q15–5B). Do these resultsallow you to order the action of Frizzled and Dishevelledin the signaling pathway? If so, what is the order? Explainyour reasoning
Recently, scientists constructed a transgene that expresses a mutant form of Drosophila histone H3 inwhich lysine 27 in the histone tail was changed to methionine (H3K27M). Expression of the H3K27Mtransgene results in aberrant development of fruit fliesbecause of inappropriate expression of many differentgenes. Explain this finding.
What is the signaling pathway that mediates the organizing activity of the A/P organizer in the Drosophila wing disc? Describe two experiments that suggest this pathway functions to organize pattern and promote growth along the anterior/posterior axis of wing imaginal discs.
Which of the following statements is FALSE? The mammalian glucocorticoid receptor: awaits the steroid hormone at the cell surface and is internalized into the cytoplasm upon glucocorticoid binding. is a hormone-dependent transcription factor. may act as an activator or repressor of transcription depending on the promoter it acts on. is sequestered in the cytoplasm by HSP90 as long as the glucocorticoid is absent. does not require phosphorylation by protein kinase A to bind DNA.
Through recombinant DNA methods, a modified steroid hormone receptor was prepared that consists of an estrogen receptor with its ligand-binding domain replaced by the ligandbinding domain from the progesterone receptor. Predict the expected responsiveness of gene expression for cells treated with estrogen or with progesterone.
In early mammalian development, compaction would likely be blocked by inhibiting expression of which of the following? a. Beta-catenin. b. E-cadherin. c. Bcl2. d. Cdx2.
What phenotypes do you think a homozygous tra1hsn animal with a gain of function mutation in the Egl1 would have.
The attenuator is an important regulatory sequence that influence gene expression. The attenuator is located within a region called the ______________________________.
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV