Lab 1 Assignment (4)

Figure 3: ● ● ● ● ● ● KDa ● 97.4 66.2 45.0 ● 31.0- 21.5 14.4 S-1 p-1 S-2 2-0 This figure was generated by centrifuging a pura sample of protein, removing the supernatant, and resuspending the pellet in the same volume as the supernatant to allow direct comparison. The supernatant and pellet samples were then prepared for SDS-PAGE identically and run via normal SDS-PAGE procedures. In the figure, "s" means supernatant and "p" means pellet. The text or number after the dash represents a different condition. For example, s-1 and p-1 are the supernatant and pellet samples under condition 1. It is not shown, but under wild-type conditions, essentially all of the protein is found in the supernatant. S-3 ● What does the intensity of each band represent? ● Would you find soluble protein in the supernatant or pellet? Why? Would you find aggregated protein in the supernatant or pellet? Why? For each condition (there are 5 different conditions), is there a higher percentage of the total protein…

Course Code: BIO121 Course Name: Principles of Biology I Read the question carefully first Answer the question-1 given figure below according to the question (a) (b) (c) with step by step clear explanation. Question 1 Figure below shows red blood cells placed in three solutions of different tonicity. HEMOLYSIS CRENATION HEMOGLOBIN Solution A Solution B Solution C (a) Which solution, A, B or C, is hypertonic? What is a hypertonic solution? (b) Explain what has happened to the cells in solution C. (c) Plant cells will also change when placed in different solutions. Describe what would happen to a plant cell when it is placed in a hypotonic solution. Explain why this is different from what happened to the red blood cells in the above figure.

16. Your Excel data graph for Serial Dilution lab:** 16a. Include a clear and labeled graph of DF (x axis) versus Absorbance (y axis). See box above for expectations and review video tutorial of this Excel work. Do not graph two of your data points: your blank or your Cuvette #1 (DF=1). 1 Q A Multiple Styles W S X 3 E D $ 4 To C R F % 5 I T V U ^ 6 G Y 7 H U 8 J BN S ( 9 K M X

1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing the membrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SF Chimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 S region, whose sequence is as follows: MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAS TEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKH TPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV…

Relative to a surrounding hypertonic solution, the cytosol of a red blood cell is ______________.

Drag the labels onto the diagram to identify the anatomical terminology describing body orientation and direction (human a Posterior (caudal) Distal Superior (dorsal) Proximal Inferior (caudal) Anterior (ventral) Posterior (dorsal) Pearson arch

19:20 uil 4G A docs.google.com Observe the figure below and answer the following questions. Does "end A" represent the plus or the minus end? Explain. "A" End Your answer Identify the structure shown in this figure and indicate one of its functions.

Cytoplasm and granule color

After three minutes, the concentration of drug Zip in the red blood cells is 10 mmoles l-1. What is the average rate of entry of drug Zip into the red blood cells in units of moles min-1 red blood cell-1 during the first three minutes after placing the red blood cells into the bathing solution? Assume that each red blood cell occupies about 1 x 10-13 liters.

Answer number 2

Question: Name Class Date Scientific Method Review

What Type of guard column, separation column, and suppressor used for anion-exchange chromatography

1:58 l 5GE Done 21 of 23 In order to model osmosis, students created an artificial cell using dialysis tubing (a thin membrane that water can pass through but that sucrose cannot) and a solution made of sucrose (a type of sugar) dissolved in water. The students filled the dialysis tubing with the sucrose solution, tied the open ends of the tube, and placed the artificial cell in a beaker containing distilled water. Artificial Cell Water Sucrose Which of the following correctly identifies whether the sucrose solution is hypertonic or hypotonic, shows the net movement of water, and predicts what will happen to the size of the artificial cell over time? Time A Hypotonic Solution HO Time В -Нурotonic Solution HO Time Hypertonic Solution HO Time D Hypertonic Solution

E:09 66 js 66 It was suspected that a particular mixture contained three components: X, Y and Z. To check this, the mixture was analyzed by thin layer chromatography. In this experiment a nonpolar solvent was used with a polar stationary phase. The following results were obtained: setvent tront EV2 lengin tine before after Answer the following questions and then check your answers. Which suspected components (X, Y or Z) are present in the sample? 2 Are there other components in the sample? 3. What is the Rf value of the unidentified component? * Which of the suspected components is the most polar? the least polar? Zainab 4:58 PM is

B, C The equations are in the other page. Thanks

10:23 have the following stock solutions: 10. Assume you sodium dodecyl sulphate (SDS) 10 % V'S M NaOH LTE Perform the calculations and state how you would make 10 mL of lysis buffer, which has the following composition in a single tube: 1% sodium dodecyl sulphate (SDS) 0.2 M NaOH CIV2 X

Example of each sketched cell please. In the circles representing the microscope field of view, sketch a few blood cells from each of the test tubes and indicate the magnification. Then, draw an arrow(s) indicating the movement of water (into the cell, out of the cell, or both equally). Tube 2 10.92 NaCl) x Tube 3 |1.0% NaCl Tube 3 13.02NaCl) Tube 1 (distilled water) Tube 2 Tube 3 (0.9% NaCl) (3.0% NaCl) McGraw-Hill Education

Biochemistry question: For the graph shown in the attachment, what is the approximate Vmax?______. What is theapproximate Km?______ Please help with question. Thank you

Biochemistry topic question: For the graph shown in the attached image, what is the approximate Vmax______? What is theapproximate Km_____? Please help. Thank you

The electronic excitation method in fluorescence and absorption spectroscopy is the same. What are some of the variations between using a fluorimeter to perform an excitation scan and an absorption scan? Do you think the two spectra should be similar? Describe.   More info attached like protocol if needed

LM 1200 LM200) LM (1200 Identify the formed element labeled "a." %3D

Please type answer not write by hend

All of the following are filamentous proteins EXCEPT

Which of the following options shows the correct order of fastest to slowest motion of chloride ions, glycine and proteins through the separating gel?      Chloride ions > Proteins > Glycine     Glycine > Chloride ions > Proteins     Chloride ions > Glycine > Protein     Protein > Chloride ions > Glycine You are trying to separate a mixture of AMP, ADP, and ATP using ion exchange chromatography. Select appropriate supplies for your experiment.     A positively charged column, deprotonated buffer, NaCl of same concentration.       A positively charged column, protonated buffer, NaCl of increasing concentration.       A negatively charged column, protonated buffer, NaCl of increasing concentration       You cannot separate nucleotides using ion exchange chromatography.

Experiment Title: Cytotoxicity Test Experiment no. 2 Objectives: Study the cytotoxicity and how it is measured. 1- Background Cytotoxicity can lead healthy living cells to three potential cellular fates. 1. Neerosis (accidental cell death): Rapid loss of membrane integrity and cell lysis 2. Apoptosis (programmed cell death): slower, more orderly, and genetically controlled 3. Cytostasis (a decrease in cell viability): cells remain alive but fail to actively grow and divide Importance of measuring cytotoxicity two major reasons 1. Either you want specific cells to die look for an adequa compound/condition (cancer and immotherapy) 2. Or you want to exclude cyto icity in specific cells (chemicals and drugs) i have a report on this subject, please solve Applications - Drug discovery proces - Oncological research - Safety evaluation of pesti ides, plantextracts, food additives, cosmetics, and my topic. industrial chemicals Classification of cytotoxicity and cell viability assays These…

Brad ford Part V. Whole Cell Lysate Protein Concentrations cell Plate Abs HI- control H2=0.450 SAMPLE (Total Protein] (mg/mL) (w/ Dilution Factor) ТОTAL TOTAL* Dilution Assay Abssos Growth Diet Vol. (uL) Vol. (uL) Factor YPAP 200 450 1,000 ***TOTAL Dilution Factor INCLUDES pre-Dilution factor x Assay Dilution factor! Sample Total Protein Concentration and Dilution Calculations Please show how you calculated the total protein concentration for one of your lysates, then how you would construct a 100 µl sample diluted to a working concentration of 1.0 mg/mL. If your diet has a total protein concentration LOWER THAN 1.0 mg/ml, then show how you would dilute your diet down to 0.1 mg/ml instead! As always, don't forget to MIND YOUR UNITS!!!

Subjective questions Question 1: Please consider the following questions related to osmosis. Intravenous solutions (IV Fluids) must be prepared so that they are isotonic to red blood cells. A 0.9 % salt solution is isotonic to red blood cells. a. Explain what will happen to a red blood cell if placed in a solution of 99.3% water and 0.7% salt? b.Explain what would happen to a red blood cell if placed in a solution of 90% water and 10% salt? Question 2: Consider the cell membrane in the below figure.

Question:- An individual can die after experiencing a high fever for a prolonged period of time. Using what you know about enzymes, explain why an individual who enters the emergency room with a high fever might be given an ice bath to lower his or her temperature

1:01 1 Describe how you would make 10mls of a solution with concentration: 10mM Glucose (MW=180.16g/mole) and 1%w/v NaCI (MW=58.44g/mole)

Topic: Determination of Protein Concentration by Spectrophotometry: The Standard Curve   The use of Beer-Lambert’s law to estimate the concentration of protein samples is limited only to dilute solutions. Explain why

10-12. For a solution in which u = 8.0 X 102, calculate %3D K for *(a) AgSCN. (b) РЫ2 s "(c) La(IO3)3. lde (d) MgNH,PO4. sp

Question:-