d. What type of inhibition is exhibited against NAD* as a cofactor? Describe what is going on in this type of inhibition. e. Referring to the mechanism below, what step is pyrazole likely interfering with given your answers in c and d? 1. binding of NAD+ to the enzyme, LADH 2. binding of C₂H5OH to LADH 3. Oxidation of C₂H5OH (This is the reaction step) and product dissociation 4. Dissociation of NADH from LADH NAD+ + LADH NAD LADH + NAD C₂H5OH LADH C₂H5OH NADH LADH + NAD LADH k₂ k + NAD LADH C₂H5OH NADH LADH + NADH+ LADH CH3CHO+H*
Q: Why is derivatization (i.e., transesterification) of triglycerides or lipids to fatty acid methyl…
A: Triglycerides are fatty acid esters of glycerol, where three fatty acid molecules are linked to one…
Q: 1. Oxidative phosphorylation and synthesis of ATP in mitochondria: • ways of ATP formation in cells…
A: Since you have asked multiple questions with multiple sub-parts, we will solve the first three…
Q: *Write structures for the straight-chain (Fischer projection) formula and the indicated anomer of…
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as monosaccharides,…
Q: When glycogen is degraded (catabolized), all of the following occur in both liver and muscle EXCEPT…
A: Glycogenolysis is the process of breaking down the stored glycogen into simple sugar units. It…
Q: Which of the choices are types of posttranslational modifications a newly synth choices that apply.…
A: Posttranslational modifications are the amino acid side chain modification in some proteins…
Q: In the last stage of cellular respiration (ETS and oxidative phosphorylation) what is the fate of…
A: ETS (Electron Transport System) is a sequential arrangement of proteins (Protein complexes I, II,…
Q: Which of the following regarding the Electron Transport Chain is INCORRECT? It can accept electrons…
A: Aerobic metabolism of 1 molecule of glucose can produce 10 NADH (6 from acetyl CoA in TCA cycle + 2…
Q: OH H Almost 30% of the cocoon of the parasitic beetle Larinus DH maculatus consists of the…
A: Carbohydrates or carbs are macronutrient consisting of Carbon, hydrogen and oxygen atoms. In nature…
Q: Which of the following are true when enzymes and substrate interact? kı E + S= k! ES- - P k-1 the…
A: Assuming the enzyme follows the first order kinetics, The rate of a formation is given by the…
Q: Problem. The student conducted a chemical experiment to prove the reducing properties of maltose…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula :…
Q: Clathrin coat features and activities it participated include Its protein chains, triskelion,…
A: Transport mechanism of macromolecules across the plasma membrane is classified as endocytosis and…
Q: Select the chemical consequences that could contribute to DNA instability at AP sites. fewer…
A: An apurinic/apyrimidinic site or abasic site can be created as a result of DNA damage or as a part…
Q: Below is a picture of beta sheets connected by crossovers. Describe what is unique about this…
A: The protein structure is organized into several levels of protein structures: the primary,…
Q: 18:249, 12 refers to a fatty acid that contains: 18 carbons, 2 double bonds, and saturation at…
A: Fatty acids are the simplest type of lipids. They are carboxylic acids with hydrocarbon chain. They…
Q: 5. Let's revisit the question from last week's problem set with the cellulase enzyme discovered by…
A: Parameters such as Km and Vmax are used for comparing enzyme activities. If we know the initial rate…
Q: Amino Acid Biosynthesis Q7.2: Describe the biochemistry behind RoundUp Ready crops, i.e., what is a…
A: The first Roundup Ready crops were genetically modified soybeans developed in 1996, that were…
Q: Label the diagram below as either passive transport (diffusion or facilitated diffusion) or active…
A: Biological membranes are structures that surround the cell or organelles and act as barriers. An…
Q: The Na-glucose symport system of intestinal epithelial cells couples the \"downhill\" transport of…
A: Recall that: The free energy for the transport of uncharged solute from a region where its…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: 4. You are to choose the members of an expedition that will climb several high mountains. Each…
A: Note: Hi! Thank you for the question. We are authorized to answer one question at a time. Since you…
Q: COPII-coated vesicles bud out of the TGN to transport proteins to the lysosomes. True False
A: COP II coat proteins direct protein and membrane trafficking in between early compartments of the…
Q: Base Adenine Guanine Cytosine Thymine Type of Bases Ring structure Number of hydrogen bonds…
A: Nucleic acid can be of 2 types: DNA (deoxyribonucleic acid) RNA (ribonucleic acid) DNA has a…
Q: Lactate dehydrogenase (LDH): structure, characteristics, isoforms and their diagnostic significance.
A: Enzymes are bio-catalyst that participate in biochemical process and they are highly specific in…
Q: how GABA balances glutamate to prevent seizures and what is one GABA drug that is used to do that.…
A: Glutamate is a precursor of GABA. The enzyme glutamate decarboxylase catalyzes the decarboxylation…
Q: (a) Estimate the Km and Vmax for the wild-type and mutant enzyme from the graph. (b) Calculate the…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Consider the reaction: H3CC-CH₂-C—S-ACP OH H3CC-CH₂-C-S-ACP a. What kind of reaction is being…
A: Fats are highly concentrated stores of metabolic energy. Synthesis of fatty acids occurs in the…
Q: Refer to the titration curve in answering the questions: 13 12 11 10 9 8 7 6 5 4 3 0 2 4 6 ← 8 10 12…
A: A titration curve is used to study the pH changes that occurs during the titration of an acid with a…
Q: Graph a double reciprocal plot that satisfy the following: a. Michaelis-Menten kinetics enzyme,…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: 5. Molecular structure and principle of action of ATP synthase.
A: Hi! Thank you for the question. We are authorized to answer one question at a time, since you have…
Q: 5. Matching Type Match Column A with Column B. Write your answer on the space provided. CAPITAL…
A: All living things go through the necessary process of respiration, which involves using oxygen and…
Q: Why is the binding of oxygen to hemoglobin cooperative while the binding of oxygen to myoglobin is…
A: Hemoglobin has 4 subunits, 2 alpha subunits, and 2 beta subunits. These 4 subunits collectively make…
Q: 20. P2 and P4 are bacteriophages of E. coli. They have the following properties: (1) When P2 phage…
A: Bacteriophage (or Phage): The viruses that infect bacteria are referred to as bacteriophages or…
Q: Using the restriction site for SalI, suggest another restriction enzyme that would cut at the same…
A: Isoschizomers are a set of enzymes that share the same recognition site in the restriction digestion…
Q: How many hydrogen bonds exist between this DNA strand and its complementary strand? 5'-CACGGGG-3'
A: Deoxyribonucleic acid (DNA) is a double stranded polynucleotide coiled around a central axis to form…
Q: a) Describe the three irreversible reactions of the Citric Acid Cycle. Ensure to indicate their…
A: Krebs cycle or tricarboxylic acid (TCA) cycle in aerobic organisms is the final stage of catabolism…
Q: The degradation of CH3 (CH₂ )10 - COOH via the beta-oxidation pathway requires: 6FAD + 6NAD+ +…
A: Fatty acids metabolism involves β-oxidation which happens in the mitochondrial matrix. In…
Q: An ion exchange resin prefers calcium over magnesium, indicated by Xcalcium = 0.6 and Ymagnesium =…
A: An ion-exchange resin or ion-exchange polymer is a insoluble resin or polymer that acts as a matrix…
Q: Most enzymes have optimum operating conditions to function at maximum rate or velocity. Some of…
A: Enzymes are proteins, which accelerate the rate of biochemical reactions. Each enzyme has an optimum…
Q: Sketch the graph for velocity v.s. substrate concentration for enzyme 1 and enzyme 2. They have…
A: Vmax is the maximal velocity that a reaction can reach when all the enzyme molecules are saturated…
Q: Why is cholesterol an important steroid?.
A: Cholesterol is a steroid. a steroid is a compound having a cyclopentanoperhydrophenanthrene (CPPP)…
Q: Calculate the ∆G°' for the complete oxidation of acetate (C2H3O2-) to CO2 by: a) aerobic metabolism…
A: In a general reaction such as: aA + bB ⇌ cC + dD At equilibrium (steady state), the concentration of…
Q: Which of the following describes the interaction between the amino acid last eluted and the anion…
A: In Ion exchange chromatography the molecules are separated according to their charge. The matrix…
Q: Think of an additional application of the Disk diffusion method based on your experience and…
A: Disk diffusion method is a culture based microbiological assay technique in which bacteria is grown…
Q: The textbook author admits the number of protons pumped from the matrix to inter-membrane space by…
A: Oxidative Phosphorylation: In a sequence of redox reactions, electrons are transferred from one…
Q: What is the sequence of the mRNA molecule synthesized from the DNA template strand…
A: The genetic information stored in DNA is copied to an mRNA through a process known as transcription.…
Q: If there are still contaminating proteins with your LDH fraction after going through 3 different…
A: Proteins are high molecular weight biomolecules made up of amino acid residues linked via peptide…
Q: 1. Researchers isolated a monomeric protein from platelets that has 2 binding sites (A and B) for…
A: It is said that there are 2 binding sites for the ligand (the ligand here is ADP) in the protein .…
Q: The TPOX locus is one of the genetic loci used for forensic analysis of DNA. The TPOX locus has the…
A: Forensics DNA profiling can be used to solve old or unsolved crimes and to identify the person…
Q: A PCR reaction was performed to amplify the CHE2 gene. The PCR primers used were designed to amplify…
A: Polymerase chain reaction is a molecular biology technique that is sued to synthesize multiple…
Q: 2. The Km of a particular enzyme is 2.0 x 105 M. If the initial velocity (Vo) is 0.16 mmol/min for…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Answer for D, and E. The answers for A, B, and C are down below.
Trending now
This is a popular solution!
Step by step
Solved in 3 steps with 1 images
- 1 a) What is meant by the ATP currency exchange ratio? Why does the oxidation of mitochondrial FADH2 generate one less ATP than oxidation of mitochondrial NADH? b) If 12 H+ are moved across the inner mitochondrial membrane by NADH oxidation, and each ATP synthesized requires 3 H+ to move through ATP synthase, why are only 3 ATP molecules produced by oxidation of each NADH?The values of the reduction potential (Eº') of the conjugated redox pairs NAD+/NADH and pyruvate / lactate are -0'32 V and -0'19 V respectively. a) Which of the two conjugated pairs has a greater tendency to lose electrons? Reason for it. b) What is the strongest oxidizing agent? Reason for it. c) If we start with 1M concentrations of each reagent and product at pH 7.0 in which sense the reaction will pass pyruvate + NADH + H+ ⇄ lactate + NAD+ d) What is the standard free energy variation (ΔGº’ at 25ºC) for the conversion of pyruvate to lactate? e) What is the equilibrium constant of this reaction?A new drug, Proinebrium, that reduces Kcat (Ki = 2.0 uM) has been developed to treat ethylene glycol poisoning. (1) What concentration of Proinebrium is required to achieve 50% inhibition of ethylene glycol metabolism by alcohol dehydrogenase when the concentraion of ethlyene glycol in the blood is 50 uM?
- What is the reaction potential for oxidation of NADH (for completely passing electrons from NADH to O2) with units? 2. What is the reaction potential for oxidation of FADH2 (from FADH2 to O2) with units? 3. Which reaction has a more negative deltaG?A mutant version of DADH can use NADP+ as a cofactor for isopropanol oxidation. Velocity data was collected from reactions at a series of NADP+ concentrations. The following trendline was obtained for a Lineweaver-Burk plot of the data: y = 0.00007x + 0.0014 Note that the NADP+ substrate concentrations are in mM and the reaction velocity was measured in nmol/min. Calculate the Km and Vmax for DADH with this substrate. Show your work.Based on the definition of kcat, substitute a value that can be measured and yet still represents the value associated with the original concentration of the R. What would the rate or velocity of the reaction be equal to under these circumstances? How can cells increase Vmax? What variable that we could change would directly impact Vmax? Would the value of KM be affected by the ways you determined that Vma,x could be increased? What does this indicate about KM? Thinking about how catalysts work, about the Michaelis-Menten Equation, and the definition of kcat, what specifically does the enzyme change in the reaction mechanism to increase the rate? If an enzyme follows the 2 step mechanism proposed by Michaelis-Menten, what do you know about this enzyme? Be very specific and comprehensive. Please answer very soon will give rating surely
- 1. A cell in an active catabolic steady state state needs to maintain A. a high cytosolic (ATP/ADP) and a high cytosolic (NADH/NAD+) ratio. B. a high cytosolic (ATP/ADP) and a low cytosolic (NADH/NAD+) ratio. C. a low cytosolic (ATP/ADP) and a low cytosolic (NADH/NAD+) ratio. D. a low cytosolic (ATP/ADP) and a high cytosolic (NADH/NAD+) ratio.Understanding the Action of Fluoroacetate on the TCA Cycle In a tissue where the TCA cycle has been inhibited by fluoroacetate, what difference in the concentration of each TCA cycle metabolite would you expect, compared with a normal, uninhibited tissue?Distinguishing the Mechanisms of Class I and Class I Aldolases Fructose bisphosphate aldolase in animal muscle is a class 1 aldolase, which forms a Schiff base intermediate between substrate (for example. fructose-1, 6-bisphosphate or dihydroxyacetone phosphate) and a lysine at the active site (see Figure I8.12). The chemical evidence for this intermediate conies from studies with aldolase and the reducing agent sodium borohydride, NaBH4. Incubation of the enzyme with dihydroxyacetone phosphate and NaBH4 inactivates the enzyme. Interestingly, no inactivation is observed if NabH4 is added to the enzyme in the absence of substrate. Write a mechanism that explains these observations and provides evidence for the formation of a Schiff base intermediate in the aldolase reaction.
- Does the complete oxidation of tridecanoic acid (C13:0) make more ATP than the complete oxidation of 9-tetradecenoic acid (C14:1, Δ9) inside human body? Show your calculation.1. Identify the oxidized coenzyme (letter abbreviation only) that participates in this reaction of the Kreb’s cycle. Succinate --> Fumarate 2. How many mol of NADH can be obtained upon the beta oxidation of stearic acid? 3. How many mol of ATP can be obtained upon the complete oxidation of 1 mol stearic acid? 4. How many steps in glycolysis in which ATO is converted to ADP?1. Consider the oxidation of the fatty acid with the common name arachidic acid. a. Draw the structure of arachidic acid. b. How many turns of the fatty acid oxidation cycle is required for the complete oxidation of arachidic acid? c. How many moles of ATP are formed from one mole of arachidic acid if the acetyl CoA produced go to the citric acid cycle and oxidative phosphorylation? Assume 1 mole of NADH is equivalent to 3 moles ATP and 1 mole FADH2 is equivalent to 2 moles of ATP. Show how you arrived at your answer