- Draw three things (take your drawing cues from slides 11/12): (i) a gene with two exons that encodes a small protein; (ii) the resulting unspliced transcript; and (iii) the mature mRNA transcript (in this simple example, there is no alternative splicing).
Q: How do health administrators played a role with the global health policy and covid?
A: The profitability of a medical station's business strategy, resource planning, and operational…
Q: I'd like you to explain to me the structure of one of your macromolecules. You should be describing…
A: Macromolecules are large molecules that are composed of smaller subunits known as monomers.…
Q: in a scientific experiment, must always be held constant. Question 10 options:…
A: There are four categories of variables in a scientific experiment: independent, dependent, control,…
Q: Eukaryotic transcription has the following regulatory upstream element (region) in addition to…
A: In Eukaryotic transcription, the cells undergo several steps for copying genetic information present…
Q: c) If no genetic variation was observed within a particular population for a given trait, what will…
A: The percentage of a characteristic that may be accounted for by genes in a particular population is…
Q: The allele for the smooth shape of pods (I) is dominant over the allele for the constricted shape of…
A: Answer and Explanation : Given that, allele for the smooth shape of pods (I) is dominant over the…
Q: six Staphylococcus aureus are inoculated into a cream pie by the hands of a pastry chef. The…
A: Staphylococcus aureus (S. aureus) is a kind of bacteria found on human skin and nasal passages. It…
Q: There are many ways you can accomplish a 1000-fold dilution. Propose 3 different serial dilution…
A: Serial dilution is a method for precisely determining a substance's concentration in a solution. To…
Q: I am a nurse and like all nurses I got really busy last week and read the orders from the MD…
A: Introduction : Osmosis is the movement of water molecules from a less concentrated solution to a…
Q: Which of the following statements is true regarding the lys2-128d reporter? Select all that apply.…
A: INTRODUCTION Lys2-128d is a reporter allele of the Spt- gene in Saccharomyces cerevisiae (yeast)…
Q: What is a clathrin coated vesicle? How does it different from COPII-coated vesicles or COPI coated…
A: Clathrin-coated vesicles are considered as the transport vesicles. They performs the role of…
Q: Importance of Understanding the Scientific Method 5. Why are the following critical to the validity…
A: For scientific study, proper understanding of the topic is needed. There are few steps which should…
Q: For fecal portal of exit, do all parasites live within the GI tract lumen? Explain.
A: Parasites are a type of organism which live in the lumen of the gastrointestinal (GI) tract. They…
Q: The term "histone code" is best described as: O The sequence of amino acids found within a histone…
A: Genetics may aid in understanding species evolution: By examining the genetics of various species,…
Q: What do proteins moving from the ER to the Golgi travel in?
A: Introduction : Endomembrane system includes cell organelles that work in a coordinated way to…
Q: Citrate Broth and Citrate Agar are a type of media that is not described in this lab. However,…
A: Citrate media is a type of microbiological growth medium used to cultivate and maintain bacterial…
Q: In order to do electron microscopy the samples had to be specially prepared. Were the cells alive at…
A: Electron microscopy is a very useful and powerful technique that allows visualisation of biological…
Q: Imagine that you are part of a research team that specializes in diagnosing disorders associated…
A: Muscular dystrophy is a collection of illnesses that impair the human body's voluntary muscles. This…
Q: describe special characteristics in the analytical techniques of natural products
A: The authentication procedure can be greatly aided by knowing the names of recognized small molecule…
Q: What are the three categories of biological agents?
A: Biological agents also referred to as biological weapons, are microorganisms, viruses, or toxins…
Q: Match the area where blood will flow within the heart during systole (1 point) If blood is in the…
A: INTRODUCTION Systole It is the period of contraction of ventricles. Diastole It is the period of…
Q: 8-The definitive host of Toxoplasma gondii (Toxoplasmosis), is: A-Cat B-Pig C-Birds…
A: Introduction: Most warm-blooded animal species, including humans, are infected by the protozoan…
Q: Create a Study Tool of Eukaryotic cell organelle. Be sure to include both structure (draw or…
A: Eukaryotic cells have a nucleus as well as membrane-bound organelles like the Golgi apparatus,…
Q: You have a 100X stock of a buffer. You need 100 ml of 1X buffer. How much buffer solution do you…
A: Stock solutions of the standard concentration are present in the laboratories. Using these stock…
Q: define epidemiology. differentiate in detail between environmental epidemiology and occupational…
A: Epidemiology is the study of the distribution and determinants of diseases and health-related states…
Q: Which of the following "weights" death, so that deaths of the very young count more than deaths of…
A: Public health and measuring the impact of premature death on a population. The concept of Years of…
Q: GIARDIA LAMBILA , Ascaris lumbricoides are common parasites found in Guyana and discuss the…
A: Introduction There are many life forms that are pathogenic to humans. Some live as a parasite…
Q: In peas, tall (T) is dominant to short (t). A homozygous tall plant is cross with a short plant. The…
A: Introduction : Punnet square is a figure that shows many genotypes that could occur in progeny…
Q: A bacteria culture starts with 140 bacteria and grows at a rate proportional to its size. After 5…
A: Given that the starting population of bacteria is 140 and it grows at a rate proportional to its…
Q: Calculate the number of ATP formed from NADH and FADH2. The calculation should be based on the total…
A: NADH and FADH2 are both coenzymes that play important roles in cellular metabolism. NADH stands for…
Q: 1) The allele for yellow seed coat in peas is dominant to the green allele. What offspring phenotype…
A: The genotypes of a specific cross or mating operation are predicted using the Punnett square, a…
Q: The most common CF mutation is AF508; it accounts for approximate 70% of all mutant CFTR alleles…
A: Cystic fibrosis (CF) is an inherited disorder that causes severe damage to the lungs, digestive…
Q: Exaplain the two methods to study the contents of transcriptomes which are microarray analysis and…
A: Transcriptome analysis may be used to find novel genes and isoforms that are not already cataloged…
Q: RNA ploymerase binds a. to the coding region of the gene b.to the 3 prime end of the gene c.to…
A: Transcription is defined as the process by which the cell used the DNA template to make RNA that is…
Q: How many different reading frames are possible in a stretch of double-stranded DNA?
A: Introduction -open reading frame = • In molecular genetics, an open reading frame (ORF) is the part…
Q: 2. Hospital patients often receive medications, nutrients, and water intravenously (IV), which means…
A: 2) IV fluids, also known as intravenous fluids, are solutions that are administered directly into a…
Q: Observe the diagrams in Figures 5 and 6 to answer the following questions. (a) Compare a red blood…
A: Cells are considered to be the basic structural and functional unit of life. The different parts of…
Q: The scientific method can be applied to many situations, even your personal life. Organize the…
A: A scientific method generally possess five basic principles. These include ; 1. To observe 2.…
Q: Ligaments have what fiber type and why? Connective Tissue: Loose and Dense Tissue Fibers (Short…
A: Note:- Please always mention the needed parts in case of multiple questions. Thank you! Every…
Q: Based upon the attached image and your answer above, what is the genotype of the unknown individual?…
A: Trait is a characteristic feature that is unique to particular individual. Each trait is represented…
Q: What is it called when you stab the nutrient agar during the inoculation step of isolating a…
A: Introduction : A solid or liquid media that contains nutrients and is used to cultivate bacteria or…
Q: There is a situation in which a gene has five exons. Please draw four possible mature products of…
A: Alternative splicing is a biological process that involves the joining of exons from the same gene…
Q: What is the structue of dopamin, and suggest the binding interactions of dopamine with the receptor.…
A: The substantia nigra and the hypothalamus are two regions of the brain that release the chemical…
Q: Homeostasis is the ability of the body to Selected Answer: Answers: keep conditions in the internal…
A: Human biology covers every element of the human body, such as evolution, genomics, ecosystem,…
Q: Describe the most common type of genetic variability.
A: Genetic variability is the presence of variation in the genetic makeup of the organisms that leads…
Q: 40 Listen Imagine that each year, 40 tons of fish meal are provided as food to captive fish in a…
A: The correct option is: 4 tons
Q: Describe how the B-cell receptor (BCR) differs from an antibody. Draw a generic example of each and…
A: INTRODUCTION B cell receptor. B cell receptor is an immunoglobulin. On the surface of B cells they…
Q: phylogentic tree with the following clades:
A: Phylogenetic Tree: Vertebrata (Crown) └─ Gnathostomata ├─ Chondrichthyes │ ├─ Cyclostomata │ ├─…
Q: Discuss the differences in the design for tests that detect antigens and antibodies
A: A strong immune system is essential for maintaining good health as it helps the body to fight off…
Q: Asap
A: A mutation occurs when the DNA sequence of a gene or chromosome changes. It can happen naturally or…
Gene Interactions
When the expression of a single trait is influenced by two or more different non-allelic genes, it is termed as genetic interaction. According to Mendel's law of inheritance, each gene functions in its own way and does not depend on the function of another gene, i.e., a single gene controls each of seven characteristics considered, but the complex contribution of many different genes determine many traits of an organism.
Gene Expression
Gene expression is a process by which the instructions present in deoxyribonucleic acid (DNA) are converted into useful molecules such as proteins, and functional messenger ribonucleic (mRNA) molecules in the case of non-protein-coding genes.
Plz asap
Step by step
Solved in 2 steps with 3 images
- Consider the following DNA sequence, which codes for a short polypeptide: 5'-ATGGGCTTAGCGTAGGTTAGT-3' Determine the mRNA transcript of this sequence. You have to write these sequences from the 5' end to the 3' end and indicate those ends as shown in the original sequence in order to get the full mark. How many amino acids will make up this polypeptide? Determine the first four anticodons that will be used in order to translate this sequence.5’ATCGCGCTAGGCGCATGCTACCTAGGCTATCTGCCTAGCTATCGACTAATCTGATCGAGTCAG3’ 3’TAGCGCGATCCGCGTACGATGGATCCGATAGACGGATCGATAGCTGATTAGACTAGCTCAGTC5’ Write out the pre-mRNA for this geneWrite out the mRNA for this geneHow many amino acids does this protein have? Translate the protein Label your 5’ and 3’ UTR’sThe code for a fully functional protein is actually coming from an mRNA transcript that has undergone post transcriptional processing which is essentially way too different from the original code in the DNA template. Given: Cytosine; a Protein with known amino acid sequence (amino acid sequence given below) MATIVNTKLGEHRGKKRVWLEGQKLLREGYYPGMKYDLELKDSQVVLRVKEEGKFTISKRERNGRVSPII DLTVQELATVFDGVEMLRVFIRNGAIVISAHHQQERVIERVNRLISKLENGESLSVCSLFHGGGVLDKAI HAGFHKAGIASAISVAVEMEGKYLDSSLANNPELWNEDSIVIESPIQAVNLSKRPPQVDVLMGGIPCTGA SKSGRSKNKLEFAESHEAAGAMFFNFLQFVEALNPAVVLIENVPEYQNTASMEVIRSVLSSLGYSLQERI LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILEPVPLDSERWKSFDYLAEKELRDK AAGKGFSRQLLTGDDEFCGTIGKDYAKCRSTEPFIVHPEQPELSRIFTPTEHCRVKGIPEELIQGLSDTI AHQILGQSVVFPAFEALALALGNSLWSWVGMMPIMVEVVDESQPVIGGEDFHWATALVDAKGTLKLSPAA KKQGMPFNIMDGQLAVYSPNGTKKSCGHEPCEYLPVMMSGDAIMVTSSLVH Requirement: Original DNA code (itemize the steps you would take to get to know the original DNA code of Cytosine in focus)
- Refer to the DNA sequence provided: 3’ -TACTGAAGCGGCAGCCCCGCATGAGTAGACCTTACT-5’ a. What is the mRNA transcript of the anticoding strand of the DNA model? b. What is the amino acid sequence of the polypeptide chain that will be translated from the mRNA in (a)?Shown below is a portion of a wild-type DNA sequence that encodes the last amino acids of a protein that is 270 amino acids long. The first three bolded base pairs indicate the frame and include the coding region. 5^ ...GCTAAGTATTGCTCAAGATTAGGATGATAAATAACTGG 3^ 3^.. CGATTCATAACGAGTTCTAATCCTACTATTTATTGACC 5^ Which strand is the template strand for transcription of this gene? Briefly explain how you know. An insertion of one base pair causes the protein to decrease in length by seven amino acids. With respect to the sequence given above, where does this insertion occur? A change of one base pair leads to the protein increasing in the length by one amino acid. With respect to the sequence given above, which base pair would you change, and what would you change this base pair for the protein to increase in the length by one amino acid?Which of the following set(s) of primers a–d couldyou use to amplify the following target DNA sequence, which is part of the last protein-coding exonof the CFTR gene?5′ GGCTAAGATCTGAATTTTCCGAG ... TTGGGCAATAATGTAGCGCCTT 3′3′ CCGATTCTAGACTTAAAAGGCTC ... AACCCGTTATTACATCGCGGAA 5′a. 5′ GGAAAATTCAGATCTTAG 3′;5′ TGGGCAATAATGTAGCGC 3′b. 5′ GCTAAGATCTGAATTTTC 3′;3′ ACCCGTTATTACATCGCG 5′c. 3′ GATTCTAGACTTAAAGGC 5′;3′ ACCCGTTATTACATCGCG 5′d. 5′ GCTAAGATCTGAATTTTC 3′;5′ TGGGCAATAATGTAGCGC 3′
- If the coding region of a gene (the exons) contains 2,100 base pairs of DNA, would a missense mutation cause a protein to be shorter, longer, or the same length as the normal 700 amino acid proteins? What would be the effect of a nonsense mutation? A sense mutation?Below is a double-stranded DNA: ATATGTGGTCTCGGTCCGTTAGGCAAT TATACACCAGAGCCAGGCAATCCGTTA Which strand functions as the transcription template, the top one or the bottom one? Explain your reasoning What is the mRNA transcript and polypeptide from this strand? In the space below, copy the DNA strand that is transcribed, and write the mRNA transcript. Identify the polypeptide chain below it. Align the mRNA and polypeptide so that it is clear which DNA bases they came from.Given the DNA sequence below: 5’-ACATGTGTACAGGCTTTGTCTGAATGGCTT-3’ 3’-TGTACACATGTCCGAAACAGACTTACCGAA-5’ Transcribe the gene. (Write the primary structure of the mRNA that will be produced.)
- . Let’s say that you have incredible skill and can isolate the white and red patches of tissue from the Drosophila eyes shown in Figure 12-24 in order to isolate mRNA from each tissue preparation. Using your knowledge of DNA techniques from Chapter 10, design an experiment that would allow you to determine whether RNA is transcribed from the white gene in the red tissue or the whitetissue or both. If you need it, you have access to radioactive white-gene DNAHere is the sequence of a portion of a bacterial gene. The template strand is on the bottom: 5’-ATGCTGCGTGCATGGGATATAGGTAGCACACGTCC-3’ 3’-TACGACGCACGTACCC TATATCC ATCGTGTGCAGG-5’ Assuming that transcription starts with the first C in the template strand, and continues to the end, what would be the sequence of the mRNA derived from this fragment? Q) Would there be an effect on translation of changing the fourthA in the template strand to a C? If so, what effect?You have just gotten back the results from an RNA-seq analysis of mRNAs from liver. You had anticipatedcounting the number of reads of each mRNA to deter-mine the relative abundance of different mRNAs. But youare puzzled because many of the mRNAs have given youresults like those shown in Figure Q8–4. How is it that dif-ferent parts of an mRNA can be represented at differentlevels?