Connect With Learnsmart Labs Online Access For Prescott's Microbiology
11th Edition
ISBN: 9781260408997
Author: Joanne Willey
Publisher: Mcgraw-hill Higher Education (us)
expand_more
expand_more
format_list_bulleted
Question
Chapter 18.5, Problem 3MI
Summary Introduction
In tandem mass spectrometry, the collection of protein fragments is run through the two mass spectrometers in a sequential manner. This forms the difference between the mass spectrometry and tandem mass spectrometry. In this method, the first spectrometer separates the proteins and fragments which are to be fragmented further. Then, the second spectrometer determines the amino acid sequence of each of the smaller fragments on the basis of the molecular weight. Thus, this technique uses two mass analyzers that are combined in series in order to select the protein.
Expert Solution & Answer
![Check Mark](/static/check-mark.png)
Want to see the full answer?
Check out a sample textbook solution![Blurred answer](/static/blurred-answer.jpg)
Students have asked these similar questions
How long is a fully extended peptide chain that contains the same number of amino acids?(The distance between consecutive amino acids in a fully extended chain is 3.5 Å; the repeat distance ofan a-helix is 5.4 Å.)
Suppose that the sequence is part of a larger globular protein.
Consider the probable location, either on the external surface
or the interior of the protein, of each of the amino
acid residues.
The table gives the hydropathy index values for selected
amino acids in the peptide.
Amino acid
Hydropathy index
alanine
1.8
isoleucine
4.5
threonine
-0.7
glutamine
-3.5
lysine
-3.9
aspartate
-3.5
The sequence of a 29 aa long peptide can be determined from the following data:
Treatment of the peptide with dansyl chloride reveals that the amino-terminal is Val.
Trypsin digestion, separation of peptides, and Edmann technique give the sequences for
peptide fragments as follows:
T-1 V-G-A-H-A-G-E-Y-G-A-E-A-T-E T-2 A-A-W-G-KT-3 V-L-S-P-A-K
T-4 T-N-V-K
Chapter 18 Solutions
Connect With Learnsmart Labs Online Access For Prescott's Microbiology
Ch. 18.1 - MICRO INQUIRY What is the function of the 3-OH...Ch. 18.1 - MICRO INQUIRY Why is it important that identical...Ch. 18.2 - MICRO INQUIRY Which step (or steps) in this...Ch. 18.2 - Retrieve, Infer, Apply Why is the Sanger technique...Ch. 18.2 - Retrieve, Infer, Apply Explain the difference...Ch. 18.2 - Retrieve, Infer, Apply Why does reversible chain...Ch. 18.2 - Prob. 4CCCh. 18.2 - Retrieve, Infer, Apply Suggest a medical and an...Ch. 18.3 - Retrieve, Infer, Apply NGS techniques are...Ch. 18.3 - Retrieve, Infer, Apply Examine figure 18.8. How...
Ch. 18.4 - Prob. 1MICh. 18.4 - Prob. 1CCCh. 18.4 - Prob. 2CCCh. 18.4 - Prob. 3CCCh. 18.5 - Figure 18.12 Metabolic Pathways and Transport...Ch. 18.5 - Prob. 2MICh. 18.5 - Prob. 3MICh. 18.5 - Prob. 1CCCh. 18.5 - Retrieve, Infer, Apply How might the following...Ch. 18.5 - Retrieve, Infer, Apply Compare and contrast...Ch. 18.5 - Retrieve, Infer, Apply Why does two-dimensional...Ch. 18.5 - Retrieve, Infer, Apply What is the difference...Ch. 18.5 - Retrieve, Infer, Apply Describe a ChIP-Seq...Ch. 18.7 - Prob. 1MICh. 18.7 - Retrieve, Infer, Apply Cite an infectious disease...Ch. 18.7 - Prob. 2CCCh. 18.7 - Prob. 3CCCh. 18 - Prob. 1RCCh. 18 - Prob. 2RCCh. 18 - Prob. 3RCCh. 18 - Prob. 4RCCh. 18 - Prob. 5RCCh. 18 - Prob. 1ALCh. 18 - Prob. 2ALCh. 18 - You are developing a new vaccine for a pathogen....Ch. 18 - Prob. 4AL
Knowledge Booster
Similar questions
- Assume you were given a mixture consisting of one molecule each of all possible sequences of a smallish protein of molecular weight 4800 daltons. If the average molecular weight of an amino acid is, say, 120 daltons, how much would the sample weigh? How big a container would you need to hold it?arrow_forwardConsider the following peptide to answer the questions below: A M A K K E S H I F T A I D E What is the total charge of this peptide at pH = 5? What is the N terminal amino acid (full name)? C terminal amino acid? How many fragments would result if this peptide underwent proteolytic cleavage with V-8 protease and what are these fragments (list them)? Would this peptide be a candidate to form an alpha helix? Why or why notarrow_forwardWhat is the approximate molecular weight of a protein with 682 amino acid residues in a single polypeptide chain?arrow_forward
- As an example, consider albumin, a protein made of a single polypeptide weighing 66,000 daltons (66 kDa). On the other hand, gamma globulin has quaternary structure: is made of four polypeptides, two of which weigh 23,000 daltons (23 kDa) each, and two of which weigh 53,000 daltons (53 kDa) each. When treated with reducing agent and SDS, the subunits separate and they all linearize. If albumin and gamma globulin were run through gel electrophoresis, which polypeptides would move the fastest? Which would move the slowest?arrow_forwardThe bacterially produced antibiotic gramicidin A forms channels in cell membranes that allow the free diff usion of Na+ and K+ ions, thereby killing the cell. This peptide consists of a sequence of Dand L-amino acids. The sequence of a segment of fi ve amino acids in gramicidin A is R-Gly-L-Ala-D-Leu-L-Ala-D-Val-R′. Complete the Fischer projection below by adding the correct group to each vertical bond.arrow_forwardHello, I am trying to understand how to calculate the overall charge of a peptide at pH = 7. Please show your work and explain how you got the answer. Here are two peptide examples (assume it consists of 20 residues): 1) 10% Gly, 20% Leu, 15% Lys, 15% Phe, 15% Gln, 25% Glu 2) 10%Gly, 15% Leu, 20% Lys, 15% Met, 15% Thr, 25% Argarrow_forward
- Consider the peptides Pro-Gin-Val-Phe-His-Asp-Cys and His-Gln-Pro-Cys-Asp-Phe-Val. How do these two peptides differ? (Select all that apply.) The two peptides have different compositions. The two peptides have different isoelectric points. The two peptides have different titration curves. The two peptides differ in amino acid sequence. [References] If you were to have a mythical amino acid based on glutamic acid, but one in which the hydrogen that is attached to the y-carbon were replaced by another amino group, what would be the predominant form of this amino acid at pH 12 if the pK, value were 10 for the unique amino group? (Select all that apply.) Both of the carboxyl groups are deprotonated. The amino acid-carries a negative 2 charge. The amino acid carries a negative 4 charge. The amino groups are in the form -NH". Both of the amino groups are deprotonated.arrow_forwardBefore high performance liquid chromatography (HPLC) methods were devised for the separation and analysis of small peptides, electrophoresis on a paper support was frequently used. Separation was affected on the basis of the charge on a peptide at different pH values. a. Calculate the pI (isoelectric point) of the following primary structures of the following protein i.) Lys- Gly- Ala- Glyii.) Lys- Gly-Ala-Gluiii.) His- Gly- Ala- Gluiv.) Glu- Gly- Ala -Gluv.) Gln-Gly-Ala-Lys b.) the migration toward the cathode, the negative pole; A for the migration toward the anode, the positive pole; and O if the peptide remains stationary.arrow_forwardYou are in the process of determining theamino acid sequence of a protein and must reconcile contradictory results. In one trial, you determine a sequence with glycine asthe N-terminal amino acid and asparagine as the C-terminal aminoacid. In another trial, your results indicate phenylalanine as theN-terminal amino acid and alanine as the C-terminal amino acid.How do you reconcile this apparent contradiction?arrow_forward
- Partial hydrolysis of a protein yielded a number of polypeptides. One of them was purified. Deduce the sequence of amino acids in this polypeptide from the following information: (a) Complete acid hydrolysis yielded ala + arg + 2ser + lys + phe + met + trp + pro (b) Treatment with fluorodinitrobenzene (FDNB, the Sanger reagent) followed by complete acid hydrolysis yielded dinitrophenylalanine (DNP-ala) and a dinitrophenyllysine (e-DNP-lys) as the only DNP derivatives. (c) Neither carboxypeptidase A nor carboxypeptidase B released a C-terminal amino acid. (d) Treatment with cyanogen bromide (CNBr) yielded two peptides: One contained ser + trp + pro. The other contained all the remaining amino acids (including the second ser). (e) Treatment with chymotrypsin yielded three peptides. One contained only ser + pro. Another contained only met + trp. The third contained phe + lys + ser + arg + ala. (f) Treatment with trypsin yielded three peptides. One contained only ala + arg. Another…arrow_forwardHair is comprised largely of keratin, a fibrous protein consisting of two a-helices wrapped around each other in a left-handed coiled-coil. The diagram below compares a partial alignment of the amino acid sequences of a form of human keratin and of ovine keratin. For each pair of dissimilar aligned amino acids, (i) indicate if a side chain is associated with a discrete charge by writing or (at pH 7) adjacent to the letter; and (ii) indicate whether each amino acid is polar (p) or apolar (a) in the case of aligned, electrostatically-neutral, side chains. In the diagram, 219 and 158 designate se-quence positions of the first aligned residue in each polypeptide strand. human II 5 219 ovine II 7c 158 FEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAE FEGYIETLRREAECVEADSGRLSSELNHVQEVLEGYKKKYEQEVALRATAEarrow_forwardс" CH2 CH2 "НaN H с. CH С" CH Нзс CHз ZI о-оarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
![Text book image](https://www.bartleby.com/isbn_cover_images/9780134580999/9780134580999_smallCoverImage.gif)
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
![Text book image](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
![Text book image](https://www.bartleby.com/isbn_cover_images/9781259398629/9781259398629_smallCoverImage.gif)
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
![Text book image](https://www.bartleby.com/isbn_cover_images/9780815344322/9780815344322_smallCoverImage.gif)
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260159363/9781260159363_smallCoverImage.gif)
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260231700/9781260231700_smallCoverImage.gif)
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education