Fill in the blanks to complete this description of important of a polypeptide into the ER. Use the provided word bank. You may use t 1. translation of polypeptide begins by a ribosome 2. recognition of the SRP by the signal sequence 3. binding of polypeptide/ribosome by the SRP receptor 4. delivery of the SRP V to the [ Select ] 5. import of polypeptide into the ER lumen through the SRP symporter 6. proteolytic cleavage of the SRP 7. continue translation > >

Fill in the blanks to complete this description of important of a polypeptide into the ER. Use the provided word bank. You may use t 1. translation of polypeptide begins by a ribosome 2. recognition of the SRP by the signal sequence 3. binding of polypeptide/ribosome by the SRP receptor 4. delivery of the SRP V to the [ Select ] 5. import of polypeptide into the ER lumen through the SRP symporter 6. proteolytic cleavage of the SRP 7. continue translation > >

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter28: Dna Metabolism: Replication, Recombination, And Repair

Section: Chapter Questions

Problem 20P: Figure 28.41 gives some examples of recombination in IgG codons 95 and 96, as specified by the Vkand...

See similar textbooks

Similar questions

Polypeptides with the ER Signal Sequence (MMSFVSLLLVGILFTATEAEQLTKCEVFQ <- one-letter amino acid abbreviations) are targeted to the ER The ER Retrieval tag (KDEL) causes proteins to remain in the ER Protein Q has both an ER signal sequence and the ER retrieval tag.
Jack is applyng to Gate's foundation for a grant to make a high affinity, humanized monoclonal antibody that could neutralize venom, a 7 kDa protein of 62 amino aicds, from cobra snakes. He argues that many people in tropical areas are bitten by the poisonous snakes and may need injection of this life-saving anitbody more than once. His friend has successfully purified the 7kDA venom protein expressed in E. coli in a large quantity and will give him whatever he needs for his project. Assume that he recovers four anti-venom monoclonal antibodies. What is the method he can use to identify the one with the highest affinity to the venom?
Jack is applyng to Gate's foundation for a grant to make a high affinity, humanized monoclonal antibody that could neutralize venom, a 7 kDa protein of 62 amino aicds, from cobra snakes. He argues that many people in tropical areas are bitten by the poisonous snakes and may need injection of this life-saving anitbody more than once. His friend has successfully purified the 7kDA venom protein expressed in E. coli in a large quantity and will give him whatever he needs for his project. How can he make anti-venom monoclonal antibodies?
Jack is applyng to Gate's foundation for a grant to make a high affinity, humanized monoclonal antibody that could neutralize venom, a 7 kDa protein of 62 amino aicds, from cobra snakes. He argues that many people in tropical areas are bitten by the poisonous snakes and may need injection of this life-saving anitbody more than once. His friend has successfully purified the 7kDA venom protein expressed in E. coli in a large quantity and will give him whatever he needs for his project. Among more than 100 candidates, what can he do to identify those that recognize the venom?
The Lariat Intermediate in RNA Splicing Draw the structures that comprise the lariat branch point formed during mRNA splicing: the invariant A. its 5â€™-R neighbor, its 3â€™-Y neighbor, and its 2â€™-G neighbor.
Exploring the Structure of the 30S Ribosomal Subunit Go to www.pdh.org and bring up PDB file 1GIX, which shows the 30S ribosomal subunit, the three tRNAs, and mRNA. In the box on the right titled â€˜Biological Assembly.â€� click â€œMore Images.â€� and then scroll down to look at the Interactive Vic By moving your cursor over the image, you can rotate it to view it from any perspective. a. How are the ribosomal proteins represented in the image? b. How is the 16S rRNA portrayed? c. Rotate the image to see how the tRNAs stick out from the structure. Which end of the tRNA is sticking out? d. Where will these ends of the tRNAs lie when the 50S subunit binds to this complex?
Each transfer RNA requires at least four specific recognition sitesthat must be inherent in its tertiary protein structure in order forit to carry out its role. What are these sites?
If the following truncated peptide represents the active domain of the COVID19’s S-protein N-terminal ----Leu-Leu-Gly-Cys-Ile-Glu-Ser-Thr-Cys-Ala ------ C-terminal a) state the RNA sequence of this peptide given that Leu is the first amino acid b) show a point mutation using the RNA sequence & explain how it results in silent mutation effect c) show a deletion mutation using the RNA sequence & explain the consequence(s)
19Eukaryotic messenger RNA and hnRNA both have poly (A) tails at their 3'-ends. Yesorno 20Messenger RNA splicing and export are uncoupled processes. Yesorno twenty oneWhich of the following plays an important role in directing newly synthesized proteins to specific cellular destinations?A.signal sequenceb.nuclear localization signalc.chain elongation stretchD.Shine – Dalgarno
One of the amino acid sequences in the lysozyme protein from the bacterial virus T4 studiesby Streisinger and co-worker was .... Lys – ser – pro – ser – leu – asn – ala – ala – lys. Thisparticular amino acid was found to have changed to lys – val – his –his –leu –met –ala –ala–lys... as a result of a single nucleotide deletion and addition approximately 15 bases apartin the mRNA. Which base was deleted and which was added? Give the altered sequence of bases inthe altered amino acid.
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
One of the amino acid sequences in the lysozyme protein from the bacterial virus T4 studiesby Streisinger and co-worker was .... Lys – ser – pro – ser – leu – asn – ala – ala – lys. Thisparticular amino acid was found to have changed to lys – val – his –his –leu –met –ala –ala–lys... as a result of a single nucleotide deletion and addition approximately 15 bases apartin the mRNA.a. What is the sequence of the nucleotides that produce the original protein.b. Which base was deleted and which was added? Give the altered sequence of bases inthe altered amino acid.