The lipid portion of a typical bilayer is about 30 Å thick.(a) Calculate the minimum number of residues in an a-helix required tospan this distance.(b) Calculate the minimum number of residues in a b-strand required tospan this distance.(c) Explain why a-helices are most commonly observed in transmembraneprotein sequences when the distance from one side of a membrane to theother can be spanned by significantly fewer amino acids in a b-strandconformation.(d) The epidermal growth factor receptor has a single transmembrane helix.Find it in this partial sequence: . . . RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH . . .
Cell Structure
The knowledge and concept about the structure of the cells have changed constantly over the past years. Primarily the scientist defines the cells as a simple membranous sac with fluids and some particles. Researches have now revealed that the cell is the more complex and basic unit of life. There are different types of cells and they also differ in shape and structure. The basic three parts of a cell are cell membrane, cytoplasm, and organelle.
Plant Cell
The smallest functional unit of a living organism is known as the cell. It is composed of cytoplasm enclosed by an outer layer known as the cell membrane. A cell is classified as a prokaryotic cell and a eukaryotic cell. A prokaryotic cell does not contain a nucleus, and the genetic material is freely suspended in the cell cytoplasm; for example, bacteria are composed of a prokaryotic cell. Whereas a eukaryotic cell contains a nucleus and membrane-bound cell organelles with a specific function, plants and animal cells are examples of eukaryotic cells.
Plant Cell Types
Plants are made up of a variety of cell types that include both living and dead cells. These cells provide them mechanical and structural support along with the growth of plants. Plant tissue is a group or collection of cells, which are similar in structure and work together to accomplish a specific function. Plant cells are most similar to animal cells, both being eukaryotic cells.
The lipid portion of a typical bilayer is about 30 Å thick.
(a) Calculate the minimum number of residues in an a-helix required to
span this distance.
(b) Calculate the minimum number of residues in a b-strand required to
span this distance.
(c) Explain why a-helices are most commonly observed in transmembrane
protein sequences when the distance from one side of a membrane to the
other can be spanned by significantly fewer amino acids in a b-strand
conformation.
(d) The epidermal growth factor receptor has a single transmembrane helix.
Find it in this partial sequence:
. . . RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH . . .
Trending now
This is a popular solution!
Step by step
Solved in 2 steps with 2 images