Campbell Biology
10th Edition
ISBN: 9781269601894
Author: Reece
Publisher: INGRAM
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 4.3, Problem 1CC
VISUAL SKILLS Ø What does the term amino acid signify about the structure of such a molecule? See Figure 4.9.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Structure Writing: Draw the structure of peptide with sequence G-A-N-D-A
Exercise A: Amino Acid Functional Groups
Figure 1 below shows one of the 20 amino acids that make up proteins. Recall that
carbon can form four covalent bonds. Amino acids consist of a central carbon, called
the a-carbon, that is bonded to four different chemical groups.
H
+
CH2
OH
Figure 1. Structure of an amino acid
Answer the below questions in your own document.
• On the amino acid shown in Figure 1, label the a-carbon.
• The a-carbon of each of the 20 amino acids is bonded to one hydrogen
atom, one amino group, one carboxyl group, and one R group (more on
that below). You should recognize the amino and carboxyl groups from our
discussion of functional groups in organic molecules. Circle and label* the
amino group and the carboxyl group in Figure 1.
*Note: our goal in this question, and in similar questions throughout this lab, is for
you to be able to identify specific structures. You can do this circling/labeling in
whatever way is easiest for you. You might want to draw the…
Prepare & define the alpha-helical structure of protein with examples
Chapter 4 Solutions
Campbell Biology
Ch. 4.1 - Why was Whler astonished to find he had made urea?Ch. 4.1 - VISUAL SKILLS See Figure 4.2. Miller carried out...Ch. 4.2 - DRAW IT (a) Draw a structural formula for C2H4....Ch. 4.2 - Prob. 2CCCh. 4.2 - How are gasoline and fat chemically similar?Ch. 4.2 - VISUAL SKILLS See Figures 4.5a and 4.7. Can...Ch. 4.3 - VISUAL SKILLS What does the term amino acid...Ch. 4.3 - What chemical change occurs to ATP when it reacts...Ch. 4.3 - DRAW IT Suggose you had an organic molecule such...Ch. 4 - How did Stanley Miller's experiments support the...
Ch. 4 - Prob. 4.2CRCh. 4 - In what ways does a methyl group differ chemically...Ch. 4 - Organic chemistry is currently defined as (A) the...Ch. 4 - Prob. 2TYUCh. 4 - MAKE CONNECTIONS Which chemical group is most...Ch. 4 - VISUAL SKILLS Visualize the structural formula of...Ch. 4 - visual skills Choose the term that correctly...Ch. 4 - VISUAL SKILLS Identify the asymmetric carbon in...Ch. 4 - Which action could produce a carbonyl group? (A)...Ch. 4 - Prob. 8TYUCh. 4 - Prob. 9TYUCh. 4 - SCIENTIFIC INQUIRY 50 years ago, pregnant women...Ch. 4 - WRITE ABOUT A THEME: ORGANIZATION In 1918, an...Ch. 4 - SYNTHESIZE YOUR KNOWLEDGE Explain how the chemical...
Additional Science Textbook Solutions
Find more solutions based on key concepts
Explain why hyperthermophiles do not cause disease in humans.
Microbiology with Diseases by Taxonomy (5th Edition)
Problem Set
True or False? Indicate whether each of the following statements about membrane transport is true (...
Becker's World of the Cell (9th Edition)
Why are mutants used as test organisms in the Ames test?
Laboratory Experiments in Microbiology (11th Edition)
11. In the early 1800s, French naturalist Jean Baptiste Lamarck suggested that the best explanation for the rel...
Campbell Biology: Concepts & Connections (9th Edition)
What is the difference between histology and radiography?
Human Anatomy (8th Edition)
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Exercise B: Peptide Bond Formation Figure 2 shows two individual amino acids, and then those same two amino acids after they have been linked together by a peptide bond to form a dipeptide. Addition of more amino acids linked by peptide bonds would form a polypeptide, the precursor to a functional protein. H H H. H H +| | H-N-Ċ- ċ-0 H-N-Ć- Ĉ-O H-N-Č -C. N-C-C- H CH2 H. CH2 H. CH2 H CH2 SH SH NH2 NH2 Figure 2. Formation of a peptide bond between two amino acids. Answer the below questions in your own document. F1. Which two amino acids are shown on the left side of Figure 2? Use the Figure They 3.2 from your text to answer this. 2. To which chemical groups do these amino acids belong? 3. Were you able to identify their chemical characteristics based on your rules? If not, you should go back and revise your rules! On the dipeptide shown in Figure 2, label the peptide bond that was formed when the two individual amino acids were joined. Label the free amino and carboxyl groups at the ends…arrow_forwardIdentify. Examine the following four amino acids (A-D): Co0 "H,N- CH "H,N CH "H;N-CH "H,N CH CH2 CH2 CH, CH CH2 CH3 CH, CH2 OH NH," B D What are their names, three-letter abbreviations, and one-letter symbols?arrow_forwardPredict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Ctermarrow_forward
- Exercise B: Peptide Bond Formation Figure 3 shows two individual amino acids, and then those same two amino acids after they have been linked together by a peptide bond to form a dipeptide. Addition of more amino acids linked by peptide bonds would form a polypeptide, the precursor to a functional protein. нн H H O нно H O +| | || H-N-C-ċ-o + +| 1 || H-N-C-C +| | || Н-N—С- С—N—C—С H CH2 H CH2 H CH2 CH2 SH SH NH2 NH2 Figure 3. Formation of a peptide bond between two amino acids. Answer the below questions in your own document. • Which two amino acids are shown on the left side of Figure 3? Use Figure 2 to answer this. • To which chemical groups do these amino acids belong? Were you able to identify their chemical characteristics based on your rules? If not, you should go back and revise your rules! On the dipeptide shown in Figure 3, label the peptide bond that was formed when the two individual amino acids were joined. Label the free amino and carboxyl groups at the ends of this…arrow_forwardFind the structure of a tetrapeptide using the clues presented below. Draw the chemical formula of the peptide. * Full hydrolysis of the peptide yields equimolar amounts of alanine, aspartic acid, glycine, serine and ammonia. * Sanger analysis of the peptide yields 2,4- dinitrophenylalanine. (formula, equation?) * Carboxypeptidase enzyme doesn't hydrolyze the peptide. (Why?) * Partial hydrolysis of the peptide yields the following fragments, each with unknown order: Ser, Ala, Gly Gly, Asp NH3arrow_forwardExercise B: Peptide Bond Formation Figure 2 shows two individual amino acids, and then those same two amino acids after they have been linked together by a peptide bond to form a dipeptide. Addition of more amino acids linked by peptide bonds would form a polypeptide, the precursor to a functional protein. нн +| | || H-N-C-Ĉ-0 H. +! | || H-N-C-ċ –0 H. H H H +| | || H-N-C-C-N-C-C- + H CH2 CH2 H CH2 H. CH2 SH SH NH, NH, Figure 2. Formation of a peptide bond between two amino acids. Answer the below questions in your own document. 1. Which two amino acids are shown on the left side of Figure 2? Use the Figure 3.2 from your text to answer this. 2. To which chemical groups do these amino acids belong? 3. Were you able to identify their chemical characteristics based on your rules? If not, you should go back and revise your rules! On the dipeptide shown in Figure 2, label the peptide bond that was formed when the two individual amino acids were joined. Label the free amino and carboxyl…arrow_forward
- Draw out the basic amino acid structure (not specific) What is a peptide bond?arrow_forward* Draw the tripeptide FTQ, making sure to care for stereochemistry.* Identify the N-terminus and the C-terminus of the peptide.* Identify what type of stabilizing interactions the amino acid side chains could employ in the tertiary andquaternary structure of a protein.arrow_forwardGTTTTCACTGGCGAGCGTCATCTTCCTACT 10. Generate a secondary structure prediction for one identified protein.arrow_forward
- I. Apply your knowledge on the basic structure of amino acids by creating a polypeptide chain that is 4 amino acids long showing its structural formula, II. Why are R groups important in amino acids?arrow_forwardGive typing answer with explanation and conclusion On paper draw a dipeptide, clearly showing the peptide bond joining the two amino acids together. If the two amino acids are valine and threonine, predict the overall charge of the dipeptide at pH 7. Do not forget to consider the amino (N-terminal) and carboxy (C-terminal) of the dipeptide, as well as the R groups. Select one: a. +2 b. -2 c. 0 d. -1 e. +1arrow_forwardName and draw the structure of 4 hydrophobic amino acidsarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education
Macromolecules | Classes and Functions; Author: 2 Minute Classroom;https://www.youtube.com/watch?v=V5hhrDFo8Vk;License: Standard youtube license