CAMPBELL BIOLOGY-MASTERING BIO.ACCESS
12th Edition
ISBN: 9780136486787
Author: Urry
Publisher: SAVVAS L
expand_more
expand_more
format_list_bulleted
Question
Chapter 7.4, Problem 2CC
Summary Introduction
To explain: The reason why the sodium-potassium pump is not considered a cotransporter.
Introduction:
The Sodium-potassium pump is an active transport system that requires energy expenditure from adenosine triphosphate (ATP) to maintain an ion concentration gradient across the plasma membrane. This pump works by transporting three Na+ ions out of the cell for every two K+ ions entering the cell. In contrast, channel proteins allow molecules to diffuse down their concentration gradient, without energy expenditure. A cotransporter is a protein that couples a substance against its concentration gradient when a substance diffuses down its concentration gradient.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
using BTPS
Dichotomous key:a. Convert the following dichotomous key into the flowchart version as described in Fig. 10.5 of your text. please refer to attached photo.
solve the for macrodrip and microdrip and round to the nearest whole number.
Order: 1000 mL D5NS IV to run at 150 mL/hr . calculate the drops per minute (gtts/min) for each of the different tubing. a) macrodrop ( 10 gtt/mL) b) microdrip ( 60 gtt/mL)
Chapter 7 Solutions
CAMPBELL BIOLOGY-MASTERING BIO.ACCESS
Ch. 7.1 - VISUAL SKILLS Carbohydrates are attached to...Ch. 7.1 - Prob. 2CCCh. 7.2 - What property allows O2 and CO2 to cross a lipid...Ch. 7.2 - VISUAL SKILLS Examine Figure 7.2. Why is a...Ch. 7.2 - MAKE CONNECTIONS Aquaporins exclude passage of...Ch. 7.3 - Prob. 1CCCh. 7.3 - WHAT IF? If a Paramecium swims from a hypotonic...Ch. 7.4 - Prob. 1CCCh. 7.4 - Prob. 2CCCh. 7.4 - MAKE CONNECTIONS Review the characteristics of...
Ch. 7.5 - As a cell grows, its plasma membrane expands. Does...Ch. 7.5 - DRAW IT Return to Figure 7.9, and circle a patch...Ch. 7.5 - Prob. 3CCCh. 7 - In what ways are membranes crucial to life?Ch. 7 - How do aquaporins affect the permeability of a...Ch. 7 - What happens to a cell placed in a hypertonic...Ch. 7 - ATP is not directly involved in the functioning of...Ch. 7 - Which type of endocytosis involves the binding of...Ch. 7 - In what way do the membranes of a eukaryotic Cell...Ch. 7 - According to the fluid mosaic model of membrane...Ch. 7 - Which of the following factors would tend to...Ch. 7 - Which of the following processes includes all the...Ch. 7 - Prob. 5TYUCh. 7 - DRAW IT An artificial "cell" consisting of an...Ch. 7 - EVOLUTION CONNECTION Paramecium and other...Ch. 7 - Prob. 8TYUCh. 7 - SCIENCE, TECHNOLOGY, AND SOCIETY Extensive...Ch. 7 - WRITE ABOUT A THEME: INTERACTIONS A human...Ch. 7 - SYNTHESIZE YOUR KNOWLEDGE In the supermarket,...
Knowledge Booster
Similar questions
- For a gradient system with a gradient of 5-90% in 50 min, flow 2 mL/min, column 100 x 4.6 mm i.d., the first peak elutes at 20 min, and the last peak elutes at 50 min. Calculate k* for this system. 2. Can isocratic elution be used for this sample? If so, what is the range of k values to be expected. 3.Propose a way to shorten the gradient run time by eliminating the wait for the first peak to elute at 20 min. 4. For the original conditions of this question, change the conditions necessary to use a 150 x 4.6 mm column while maintaining the same k* value.arrow_forwardhi can you find the maximum binding capacity(b max) using the tablearrow_forwardorder: Pitocin(oxytocin) drip at 45 microgtt/min. The solution available is 20 units of Pitocin in 1000ml of D5W. calculate unit/minarrow_forward
- how did you get 104 as the dilution factor? I got 10-2 as the dilution factor for the CNFL platearrow_forward3) What specific proteins might be targeted for up- or downregulated adsorption when designing an implantable material? Please list at least two for each.arrow_forwardThe effect of pressure on flow rate Set-up: For investigating the effect of pressure (height of a column of liquid), a 50-mL burette was used with a small length of rubber tubing fixed to the bottom on which a clamp could be fitted to start/stop the flow of water (Figure 1). Effluent was collected in a beaker and mean flow rate was calculated (mL/s), and a stopwatch was used to measure how long it took for 5 mL of liquid to flow out. For the subsequent sections of the practical, a 25-mL burette was used, and the top was connected via rubber tubing to a 5-liter reservoir placed on the shelving above the bench. The tubing at the base was connected to the different flow modules that comprised the different configurations of tubes to be tested. Interpret the graph. What does this relate to in the cardiovascular system, and is it something that can change? How? What would be the implications for our ability to control blood flow to different tissues, if this were the only control mechanism…arrow_forward
- Calculate the elution volume of blue dextran (blue), myoglobin (red), and Bromocresol purple (purple) in the gel filtration chromatography below with a flow rate of 2.5 mL/min. (Take note that the black colored test tubes represent colorless eluents)arrow_forwardGel-filtration chromatography separates molecules according to their size . Smaller molecules diffuse faster in solution than larger ones, yet smaller molecules migrate more slowly through a gel- filtration column than larger ones. explain this paradox. What should happen at very rapid flow rates?arrow_forwardBriefly describe the middle of the Ion exchanger Chromatographyarrow_forward
- ca2+ possible negative ionarrow_forwardComplete this mechanismarrow_forward1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing the membrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SF Chimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 S region, whose sequence is as follows: MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAS TEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKH TPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV…arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Physiology: From Cells to Systems (MindTap ...BiologyISBN:9781285866932Author:Lauralee SherwoodPublisher:Cengage Learning
Human Physiology: From Cells to Systems (MindTap ...
Biology
ISBN:9781285866932
Author:Lauralee Sherwood
Publisher:Cengage Learning