The enzymes required to breathe fire (BFi2) is expressed in throat tissues of dragons from the Known World (comprising Westeros, Essos, Sothyros, and Ulthos) at various times during their life cycles. A test very similar to DNase I hypersensitivity is conducted on embryonic (E) and adult (A) throat tissue samples of Valeriyan, Ice and Sea dragons. In the analysis, a radioactive label is attached to one end of each chromosome fragment, and the samples from each tissue are exposed to DNase I to determine if regions of BFi2 are DNase I hypersensitive. The content from each sample is then separated by gel electrophoresis and the results are shown below.

The enzymes required to breathe fire (BFi2) is expressed in throat tissues of dragons from the Known World (comprising Westeros, Essos, Sothyros, and Ulthos) at various times during their life cycles. A test very similar to DNase I hypersensitivity is conducted on embryonic (E) and adult (A) throat tissue samples of Valeriyan, Ice and Sea dragons. In the analysis, a radioactive label is attached to one end of each chromosome fragment, and the samples from each tissue are exposed to DNase I to determine if regions of BFi2 are DNase I hypersensitive. The content from each sample is then separated by gel electrophoresis and the results are shown below.

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter32: The Reception And Transmission Of Extracellular Information

Section: Chapter Questions

Problem 21P

See similar textbooks

Similar questions

Lewis Blood Group System is a human blood group unlike most others. The antigen is produced and secreted by exocrine glands, eventually adsorbing to the surface of red blood cells. Its expression is based on the genetic expression of the Lewis and Secretor genes. Based on the following genotype (Le) (sese), what would you predict the Lewis antigen phenotypic expression to be?
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
Identify the two general functions of the proteins encoded bytumor-suppressor genes.
Your collaborator from Fisk University has isolated proteins from healthy prostate cancer cells. You want to compare and contrast the two protein expressions from part 4. Write up the procedure to examine protein expression from the prostate cancer cells and healthy prostate cancer cells.
he human phenotype is regulated by epigenetic control of gene expression. Discuss the three main types of epigenetic regulation, illustrating your answer with examples of diseases arising from impairment of each of these processes
During certain stages of development, the requirement forcertain gene products may require gene amplification. Whatpurpose does gene amplification serve?
Suppose that in the formation of phenylalanine hydroxylase mRNA, the exons of the pre-mRNA fail to splice together properly and the resulting enzyme is nonfunctional. This produces an accumulation of high levels of phenylalanine and other compounds, which causes neurological damage. What phenotype would be produced in the affected individual?
Equalizing the Expression of X Chromosome Genes in Males and Females Males have only one X chromosome and therefore only one copy of all genes on the X chromosome. Each gene is directly expressed, thus providing the basis of hemizygosity in males. Females have two X chromosomes, but one is always inactivated. Therefore, females, like males, have only one functional copy of all the genes on the X chromosome. Again, each gene must be directly expressed. Why, then, are females not considered hemizygous, and why are they not afflicted with sex-linked recessive diseases as often as males are?
Through recombinant DNA methods, a modified steroid hormone receptor was prepared that consists of an estrogen receptor with its ligand-binding domain replaced by the ligandbinding domain from the progesterone receptor. Predict the expected responsiveness of gene expression for cells treated with estrogen or with progesterone.
A certain nonsense suppressor corrects a nongrowingmutant to a state that is near, but not exactly, wild type(it has abnormal growth). Suggest a possible reason whythe reversion is not a full correction.
Expression of ---- does not require new protein synthesis. a.immediate early genes b. delayed early genes c. late genes. One growth factor can activate different pathways because ---- a. growth factor receptor dimerizes b. receptor transphosphorylates c. each receptor binds to several different proteins that have SH2 domains d. structural changes occur in proteins of signal transduction pathway. According to Knudson’s two-hit hypothesis, in children with familial retinoblastoma, a. only a single somatic mutation is needed to eliminate Rb function. b. children have genetically wild type gene at the Rb locus, and retinoblastoma development requires two successive somatic mutations c. both a and b are a possibility Methylation of a promoter results in a. overexpression of the downstream gene b. suppression of expression of the downstream gene.
Many genes whose expression is turned on by DNAdamage have been isolated. Loss-of-function mutations in the lexA gene lead to the expression of manyof these genes, even when there has been no DNAdamage. Would you hypothesize that LexA protein isa positive or a negative regulator? Why?