Concept explainers
(a)
To determine: The charge category of lysine.
Introduction: Lysine can be defined as an amino acid that is essential for the biosynthesis process of proteins. Lysine also has many other applications in the field of medicine.
(b)
To determine: The property of lysine that enables it to interact with the DNA.
Introduction: The DNA or the deoxyribonucleic acid is composed of
(c)
To determine: The effect of acetylation on lysine interaction with the DNA and gene expression activation.
Introduction: The process of acetylation is a
Want to see the full answer?
Check out a sample textbook solutionChapter 19 Solutions
EBK CONCEPTS OF GENETICS
- If an extra nucleotide is inserted in the first exon of the beta globin gene, what effect will it have on the amino acid sequence of the globin polypeptides? Will the globin most likely be fully functional, partly functional, or nonfunctional? Why?arrow_forwardBovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?arrow_forwardWhat amino acids do the following sequences code for?(a) AUC (b) GCU (c) CGA (d) AAGarrow_forward
- When glycoproteins are synthesized in the cell, at what stage of the polymerization of the protein are the sugar groups added: Prior to translation, cotranslationally, or posttranslationally?arrow_forwardWhich are the Characteristics of Regulation of Binding Site?arrow_forwardConsider the following in light of the concept of levels of structure (primary, secondary, tertiary, quaternary) as defined for proteins. (a) What level is shown by doublestranded DNA? (b) What level is shown by tRNA? (c) What level is shown by mRNA?arrow_forward
- How does the information stored in DNA direct the synthesis of proteins?arrow_forwardFamilial hypercholesterolemia is a genetic condition characterized by an absence of functional LDL receptors on the surface of cells. Patients who are homozygous for familial hypercholesterolemia usually die of coronary artery disease in childhood. Which of the following disorders could mimic the symptoms of familial hypercholesterolemia? (A) LDL receptor endocytosis machinery is non-functional (B) lack of ATP allosteric site on AMPK(C) Golgi proteases that cleave SREBP are not synthesized (D) mutation in the HMG CoA reductase SRE sequence. (E) inability to secrete VLDL from the liverarrow_forwardWhat are the possible phosphorylation sites in a target protein?arrow_forward
- What kind of biological function would each of the follow- ing proteins perform? (a) Human growth hormone (b) Myosin (c) Protease (d) Myoglobinarrow_forwardHow does the cell ensure that a specific amino acid (say, valine) attaches itself only to the one tRNA molecule that is specific for valine? (A) Proteins called aminoacyl DNA synthetases are responsible for bringing together the proper pair. The enzymes match the amino acid and one of the correct DNA molecules carrying the right anticodon. (B) Lipids called aminoacyl tRNA synthetases are responsible for bringing together the proper pair. The lipid binds the amino acid and one of the correct tRNA molecules carrying the right codon. (C) Enzymes called aminoacyl tRNA synthetases are responsible for bringing together the proper pair. The enzymes match the amino acid and one of the correct tRNA molecules carrying the right anticodon. (D) Enzymes called peptidyl mRNA synthetases are responsible for bringing together the proper pair. The enzymes match the amino acid and one of the correct mRNA molecules carrying the right anticodon.arrow_forwardPresent the Two different representations for the triple helix of collagen ?arrow_forward
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningHuman Biology (MindTap Course List)BiologyISBN:9781305112100Author:Cecie Starr, Beverly McMillanPublisher:Cengage Learning