EBK CONCEPTS OF GENETICS
12th Edition
ISBN: 9780134818979
Author: Killian
Publisher: YUZU
expand_more
expand_more
format_list_bulleted
Concept explainers
Question
Chapter 25, Problem 2CS
Summary Introduction
To determine: Whether an individual would disclose WGS results to the parents and reason for the disclosure.
Introduction: WGS (whole genome sequencing) provides sequencing results for entire genome, including noncoding regions. WGS can identify mutations in regulatory regions that lead to disease.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Forward Genetics Analysis uses a variety of beneficial approaches to identify never before described genes.
For each of the following approaches or outcomes, briefly (maximum 2 sentences) discuss in your own
words, their purpose in Forward Genetics Analysis.
c) Mendelian ratios
d) Genetic screen
Describe the methodology that you would use to determine the association between specific sequence variations or epigenetic modifications and observed diseases in humans. Given your newfound knowledge of this association how would you then design a genetic test that could be used to identify individuals within a given population who have developed the disease or at risk of developing the disease. “The disease” here refers to any heritable genetic disease..
In your attempts to identify a genetic basis for rheumatoid arthritis in humans, you have DNA samples from three large unrelated families in which individuals with varying
severity of rheumatoid arthritis are found. From your analysis of various SNPs, you find that the same four unlinked loci consistently show a correlation with the most severe
cases from all three families.
Based on your observations, which of the following hypotheses best describes the genetic control of rheumatoid arthritis?
ос
Rheumatoid arthritis is the result of phenocopy by the environment
Different genes regulate the disease in different families
Rheumatoid arthritis is controlled by a single X-linked recessive trait
Rheumatoid arthritis is controlled by polygenic (or quantitative) traits
Rheumatoid arthritis is controlled by a single autosomal dominant trait
Chapter 25 Solutions
EBK CONCEPTS OF GENETICS
Ch. 25 - A homozygous plant with 20-cm-diameter flowers is...Ch. 25 - The following table shows measurements for fiber...Ch. 25 - The following cable gives the percentage of twin...Ch. 25 - At an interview with a genetic counselor, a couple...Ch. 25 - Prob. 2CSCh. 25 - At an interview with a genetic counselor, a couple...Ch. 25 - HOW DO WE KNOW? In this chapter, we focused on a...Ch. 25 - CONCEPT QUESTION Review the Chapter Concepts list...Ch. 25 - Define the following: (a) polygenic, (b) additive...Ch. 25 - A dark-red strain and a white strain of wheat are...
Ch. 25 - Height in humans depends on the additive action of...Ch. 25 - An inbred strain of plants has a mean height of 24...Ch. 25 - Erma and Harvey were a compatible barnyard pair,...Ch. 25 - In the following table, average differences of...Ch. 25 - What kind of heritability estimates (broad sense...Ch. 25 - List as many human traits as you can that are...Ch. 25 - Corn plants from a test plot are measured, and the...Ch. 25 - The following variances were calculated for two...Ch. 25 - The mean and variance of plant height of two...Ch. 25 - Prob. 14PDQCh. 25 - Prob. 15PDQCh. 25 - In an assessment of learning in Drosophila, flies...Ch. 25 - Prob. 17PDQCh. 25 - Prob. 18PDQCh. 25 - In a population of 100 inbred, genotypically...Ch. 25 - Many traits of economic or medical significance...Ch. 25 - A 3-inch plant was crossed with a 15-inch plant,...Ch. 25 - In a cross between a strain of large guinea pigs...Ch. 25 - Type A1B brachydactyly (short middle phalanges) is...Ch. 25 - In a series of crosses between two true-breeding...Ch. 25 - Students in a genetics laboratory began an...Ch. 25 - Prob. 26ESPCh. 25 - Canine hip dysplasia is a quantitative trait that...Ch. 25 - Floral traits in plants often play key roles in...Ch. 25 - In 1988, Horst Wilkens investigated blind...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- As a genetic counselor, you are asked to assess the risk for a couple with a family history of familial adenomatous polyposis (FAP) who are thinking about having children. Neither the husband nor the wife has colorectal cancer, but the husband has a sister with FAP. What is the probability that this couple will have a child with FAP? Are there any tests that you could recommend to help in this assessment?arrow_forwardFollowing the tragic shooting of 20 children at a school in Newtown, Connecticut, in 2012, Connecticut’s state medical examiner requested a full genetic analysis of the killer’s genome. What do you think investigators might be looking for? What might they expect to find? Might this analysis lead to oversimplified analysis of the cause of the tragedy?arrow_forwardPedigree Analysis Is a Basic Method in Human Genetic: What does OMIM stand for? What kinds of information are in this database?arrow_forward
- A research team interested in mapping human genes discovered a new restriction length polymorphism (RFLP). The nature of the polymorphism is shown in the figure below. a) They test the RFLP in a family with the pedigree below. The individuals colored blue are affected by hemophilia, a blood-clotting disease. On what chromosome is the RFLP found?arrow_forwardISSR is generally a dominant STS DNA marker. Nonetheless, with validated experimental evidence (e.g. laboratory and population genetics data), the marker can be used in codominance marker genotyping. Briefly explain each case below: a) Codominant marker targets specific locus and reveals allelic variations in that locus among DNA samples. b) Dominant marker: primers can complement other repeat sequences or in multiple loci thereby non-specificity in sampled genomes.arrow_forwarda) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forward
- this is what i have said about this image so far, what else can be said aswell including the raw count column. " Interpreting the results of an RNA-Seq analysis is pivotal in understanding the underlying genetic mechanisms of diseases such as breast cancer. In this analysis, Figure 1 provides comprehensive data on differentially expressed genes associated with breast cancer. By delving into the provided information, we can gain valuable insights into the molecular landscape of this disease. First focus is on the gene with the highest fold change, EYA4, situated on chromosome 6. With a staggering fold change of 3604.4176, EYA4 exhibits an unprecedented level of overexpression in cancerous cells compared to normal cells. This profound alteration suggests a pivotal role for EYA4 in breast cancer pathogenesis. The log2 fold change of 11.81555 further emphasizes the magnitude of this difference in gene expression. Statistical significance is evident, with an exceptionally low p-value of…arrow_forward24. 23andme is a direct to consumer genotyping company that uses a microarray to genotype people on 1 million known SNPS in the genome. A man who was adopted wants to know about his ancestry, and purchases a 23andme kit for himself. He finds that of each autosome pair, exactly one is classified as 100% Sub-Saharan African, while the other is a mixture of various East Asian and European components. He also finds that his X chromosome is 100% Sub-Saharan African. What can this man confidently infer about his recent ancestry? a. His mother was of Sub-Saharan African descent b. His father was of Sub-Saharan African descent c. He has no Neanderthal ancestry d. He has no mutations relative to his parents e. 23andme mixed up two samples and he can't infer anythingarrow_forwardA small-scale pedigree study involving 15 families with a total of 50 children was performed to determine whether a SNP in a candidate gene is linked to a disease. The result showed that among 22 children who developed the disease, 19 belonged to non-recombinants while 3 recombinants. For the remaining 28 children, 21 were non-recombinants and 7 belonged to recombinants. A Lod (Z) score can be calculated and used to determine whether this SNP is linked to the disease. By using a very stringent threshold, which of the following conclusions is correct? O A.Z is approximately 4.03, indicating a linkage O B. Z=0.25, indicating no linkage OCZ=0.2, indicating no linkage O D.Z is approximately 4.19, indicating a linkagearrow_forward
- In a clinical context, doctors are evaluating a therapy for a new patient (say patient B) that they have reasons to believe might develop a cancer similar to another patient they treated successfully (patient A). They know that the severity of the cancer is mainly associated with mutations in a specific gene (BRCAI). Suggest a technique that can be used to rapidly assess the similarity between the genetic panerns of patients A and B, without the need to sequence the entire gene, and briefly describe it. A team of scientists are interested in the amplification of a specific DNA fragment in a large plasmid of about 10000 bps. (0) (11) The sequence the scientists are interested in is 5'-CATTGATTATTG[...JATCAATTACGGG-3" 3-GTAACTAATAAG[...]TAGTTAATGCCC-5* Where [...] indicates a longer 100bps sequence. Provide two possible primers that the scientists should use to address their need, if they want to be sure they specifically address this region in the entire plasmid. Briefly explain the…arrow_forwardThe majority of GWAS associated variants exist in non-coding regions. This has led to additional challenges in understanding the biological mechanisms behind the trait, as the associated variants may not have a clear impact on gene function. Explain two non-coding mechanisms and how they contribute to genetic variation. In your answer, mention what types of sequencing data would assist in determining whether a non-coding GWAS locus may operate under these mechanisms.arrow_forwardDescribe the main technique for amplifying a segment of DNA (like the one you suspect is involved in Lee’s cancer) from a complex mixture of genomic DNA. Remember that the entire human genome sequence is known. (Hint: This is a technique that is commonly used by laboratories that do genetic testing and various other applications of molecular biology.)arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Genetic Variation and Mutation | 9-1 GCSE Science Biology | OCR, AQA, Edexcel; Author: SnapRevise;https://www.youtube.com/watch?v=bLP8udGGfHU;License: Standard YouTube License, CC-BY