Use the values provided below to calculate the predicted isoelectric point, pl, value for aspartame.HONH2NH2phenylalanineaspartic acidpКа1 а-СООН%3D 1.83pKa2 a-NH3* = 9.13pКa1 а-СООН %3D 1.88pKa2 a-NH3* = 9.60pKa3 side chain-COOH = 3.65%3D

Isoelectric point: Isoelectric point of a amino acid is the pH at which amino acid has a neutral…

Use the values provided below to calculate the predicted isoelectric point, pl, value for aspartame HO. HO. OH, NH2 NH2 phenylalanine aspartic acid pKa1 a-COOH = 1.83 pKa2 a-NH3* = 9.13 pКа1 а-СООН %3D1.88 pKa2 a-NH3* = 9.60 %3D pKa3 side chain-COOH = 3.65

Use the values provided below to calculate the predicted isoelectric point, pl, value for aspartame HO. HO. OH, NH2 NH2 phenylalanine aspartic acid pKa1 a-COOH = 1.83 pKa2 a-NH3* = 9.13 pКа1 а-СООН %3D1.88 pKa2 a-NH3* = 9.60 %3D pKa3 side chain-COOH = 3.65

Organic Chemistry

9th Edition

ISBN:9781305080485

Author:John E. McMurry

Publisher:John E. McMurry

Chapter26: Biomolecules: Amino Acids, Peptides, And Proteins

Section26.SE: Something Extra

Problem 50AP: The -helical parts of myoglobin and other proteins stop whenever a proline residue is encountered in...

See similar textbooks

Related questions

Q: Given pKa values for ionizable groups from Table 27.2, sketch curves for the titration of Q.)…

Q: Draw the structures and indicate the net charge of the following amino acids for each pH value.…

A: Amino acid are amphoteric biomolecules which will have both acid group and basic group amine group…

Q: Of the three, which would elute last during a size-exclusion chromatography at pH 7.0? Peptide 1:…

A: Size-exclusion chromatography is one type of chromatographic technique use to separate larger…

Q: You have been given a mixture of lysine of isoelectric point of 9.74, Histidine of isoelectric point…

A: The given Isoelectric point is the pH of an amino acid at which it has no net electric charge.…

Q: XI. Compare and contrast the following protein characterization techniques in terms of the…

A: The solution of the question is given below: “Since you have posted a question with multiple…

Q: One of the most advanced methods for determining a protein sequence is tandem mass spectrometry…

A: Tandem mass spectroscopy includes the coupling of two or more mass analyzers to significantly…

Q: Determine the pl for this synthesized pentapeptide: A-B-C-D-E Given that the pK values for the amino…

Q: For the following peptide chain WHD (Tryptophan-Histidine-Aspartic acid) : pH = 8 Given pKa value…

A: If the pKa of acid is lower than the pH of the solution then the proton will remain intact and will…

Q: Hemoglobin A has a pI value of 5.6 whereas the variant hemoglobin M has an aspartate residue in…

Q: Estimate the charge of the following oligopeptides at pH 7 based on the pKa values of the…

Q: The isoelectric point, pl, of the protein deoxyribonuclease I is 10.2, while that of clostripain is…

A: •Firstly understand about ISOELECTRIC POINT:-Isoelectric point is that value of pH where a molecule…

Q: Use these pka values to calculate the charge on the peptide below at pH 6. alpha COOH 2.0 side Chain…

A: T: Threonine, pKa: 9.0 S: Serine Y: Tyrosine, pKa: 10.0 M: Methionine C: Cysteine, pKa: 8.0 F:…

Q: Brucine is a poisonous alkaloid obtained from Strychnos nux vomica, a tree that grows in India, Sri…

A: Figure 1

Q: The maximum number of amino acid side chains that can potentially form an ionic bond (+lil-…

A: Histidine is an amino acid with a imidazole ring attached as a substituent. The polarity of…

Q: The amino acid histidine has ionizable groups with pKa values of 1.8, 6.0, and 9.2, COOH H₂N-CH CH…

A: GIVEN The pKa1, pKa2 and pKa3 values of Histidine are given as 1.8, 6.0 and 9.2. Initial pH of…

Q: A new protein of an unknown structure ha graphy (gel filtration) reveals that the native absence of…

A: Given: weight of native protein - 100 kDa dithiotreitol - 50 kDa

Q: Determine the pl for this synthesized pentapeptide: A-8-C-D-E Given that the pk values for the amino…

A: A biomolecule having both acidic COOH group and basic NH2 group is knownas amino acid We are…

Q: Which side chain would most likely be found in the interior of a protein, away from the aqueous…

A: Hydrophobic amino acids have little or no polarity in their side chains. The lack of polarity means…

Q: His-Met-Asp-Tyr-Phe-Ser Calculate an approximate pI (isoelectric point) for this peptide.

A: The isoelectric point (pI) is defined as that pH of aqueous solution of amino acids where the…

Q: Doaw fae and mer igemer [RI(2-(m-todyalaze) pyidine),7

Q: (b) Describe how the charge of some amino groups in a protein might differ at pH 9.0 and pH 5.0.…

A: Polypeptides are polymers of amino acids that make up proteins. The amino (–NH2) and carboxylic acid…

Q: The amino acid histidine has ionizable groups with pKa values of 1.8, 6.0, and 9.2, as shown. COOH…

Q: Draw a formula for Thr-Ala-Ala (T-A-A) in its predominant ionic form at pH 7.3. You may assume for…

A: Here we are required to draw the structure of peptide predominant at pH 7.3

Q: 1H 19F has a force constant of 966 N m-1. Calculate the frequency of light corresponding to the…

A: In infrared spectroscopy, the infrared radiation interacts with the molecule to give the spectra.…

Q: Consider a histidine residue within a protein. Based on the histidine side-chain pKa value of 6.0…

A: Histidine is a basic amino acid used to make up proteins which contain an amino group and a…

Q: Please consider the structural formula of the amino acid shown below when answering the following…

A: (A) draw the form of this amino acid that predominates at pH 8 This pH is highly basic so that both…

Q: This is a three-part question about a tripeptide. Answer all three sub-questions. The pKR of side…

Q: ogen pept is rigid, take place about the N-Co and the Co-C bonds in a protein (Co is the a carbon…

Q: 5. A histidine residue (His146) in Hb subunit has a side chain pKa of 6.2 in the lung. Due to a…

Q: The maximum number of amino acid side chains that can potentially form an ionic bond (+lI-…

A: The structure of side group is shown below: It has two Nitrogen atoms in the ring capable of…

Q: The amino acid (S)-alanine has the physical characteristics listed under the structure. How does the…

A: Enatiomers: Enatiomers can be defined by saying that the optical active compounds which can rotate…

Q: Why is glycine the only amino acid commonly observed in peptides inconformations with phi and psi…

Q: The amino acid sequence shown below is a short excerpt (residues 130-172) from the rod domain of an…

A: Following the rules of conservative amino acids, the amino acids that when replaced with a…

Q: Valine has pKa's of 2.286 and 9.719. Estimate the fractional composition of Valine in the -1 form at…

A: Amino acids are amphoteric in nature due to the presence their ionizable α-amino and α-carboxylic…

Q: Determine the pl for this synthesized pentapeptide: A-B-C-D-E Given that the pK values for the amino…

A: Amino acid are biomolecules which have both acidic and and basic group We are required to find the…

Q: Which of the following protein assays does not make use of the copper (I or II) ions in the…

A: The purpose of the protein assay is to determine the concentration of a protein out of different…

Q: 4

A: DNA strands are negatively charged so, they are attracted by the positive electrode. In gel…

Q: b. Draw phi-psi angles about a valine from a short peptide indicating: 1) a phi-angle of+100° and 2)…

A: The phi-angle is referred as the dihedral angle between the groups attached to the nitrogen of the…

Q: Draw a structure for a peptide that gives Ala, Leu & Val on hydrolysis and fails to react with…

A: Amino Acids Amino acids are very essential for our body and facilitate numerous biological…

Q: Given the chart of pKa’s below, calculate the isoelectric point for tyrosine

A: Isoelectric point (pI):The isoelectric point is the pH of an aqueous solution of an amino acid (or…

Q: Chemistry Given TETRAPEPTIDE: Prolinyl-Argininyl-Cysteinyl-Tryptophan Predict the direction of the…

A: The given peptide according to the given sequence is: Proline makes the N terminal of the peptide.…

Q: Which of the following technique/s can be used to determine the amino acid sequence of a polypeptide…

A: A technique of chemical sequencing is used for nucleolus-specific partial chemical modification of…

Q: Ornithine is an amino acid that is not used in the synthesis of proteins, but is an important…

A: orthinine has a 3 ionizable groups. 1. amino group 2. carboxylic group 3. and a side chain pka of…

Q: Calculate the pI of this peptide. Calculate the net charge of this peptide at pH 2, pH 7, and pH 11.

Q: Calculate the percentage ionization (i.e. [base]/[acid]x100) in these amino acid side chains at the…

A: Since you have posted a question with multiple sub-parts, we will solve first three subpartsfor you.…

Q: The following table shows the distance moved in an SDS-polyacrylamide gel by a series of marker…

A: Given:

Q: Taking the structure of the amino acids into account, give a comparative discussion pK values where…

Q: Which has a higher percentage of negative charge at physiological pH (7.4), leucine with pI = 5.98…

A: When an amino acid is placed in a solution which has a pH that is lower than the pI then the amino…

Q: The shaded area in the following diagram shows CH₂ CH₂ ? H N-HO -CH₂ C-OH-N Gly 193 H RN O Covalent…

Q: The term used to separate a mixture of enantiomers of amino acids using chiral reagents? A)…

A: When enantiomer of mixture are separated using chiral reagent is called isomeric resolution . In…

Concept explainers

Spectroanalytical Methods

Spectroanalytical methods measure the wavelength and intensity of radiations that are either emitted or absorbed by a molecular or atomic species. These methods are useful for evaluating the electronic or atomic arrangement of the molecules of a given analyte.

Question

Use the values provided below to calculate the predicted isoelectric point, pl, value for aspartame.
HO
NH2
NH2
phenylalanine
aspartic acid
pКа1 а-СООН%3D 1.83
pKa2 a-NH3* = 9.13
pКa1 а-СООН %3D 1.88
pKa2 a-NH3* = 9.60
pKa3 side chain-COOH = 3.65
%3D

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

pI of phenylalanine

VIEW

pI of aspartic acid

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 3 steps with 2 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

Two phenylalanine residues are separated by 1.0 nm in a polypeptide. Calculate the dispersion interaction (kJ×mol-1). (a = 1.0 ´ 10-29 m3) I = 500 kJ×mol-1 ( ) -0.204 ( ) -0.133 ( ) -0.0688 ( ) -0.0375 ( ) -0.0233
An amino acid mixture of phenylalanine, glycine and glutamic acid is to be separated bypaper chromatography. The solvent is less polar than water. Which of these amino acids will have the highest Rf value and which the lowest? Explain. Treatment of a new protein with dansyl chloride reveals two (2) dansyl-labelled derivatives of amino acids, alanine and methionine. What can you deduce about the structure of the protein from these results? Name the amino acids that contribute atoms to both purine and pyrimidine rings.
Why is glycine the only amino acid commonly observed in peptides inconformations with phi and psi values which are not restricted to the values in the Ramachandran plot below?
Hemoglobin A has a pI value of 5.6 whereas the variant hemoglobin M has an aspartate residue in place of the normal valine at position 85 of the alpha chain. What effect will this substitution have on the electrophoretic behavior of the protein at pH 7.0. (explain clearly the reason for your answer)
Without performing a calculation, predict whether the standard entropies of the following reactions are likely to be positive or negative:(a) Ala-Ser-Thr-Lys-Giy-Arg-Ser (tryspin) → Ala-Ser-Thr-Lys + Giy-Arg(b) N2(g) + 3 H2(g) → 2 NH3(g)(c) ATP4-(aq) + 2 H2O(l) → ADP3-(aq) + HPO4 2-(aq) + H3O+(aq)
The following sequence is part of a globular protein. Predict the secondarystructure in this region. ... RRPVVLMAACLRPVVFITYGDGGTYYHWYH ...
What are the net charges of the following five-amino-acids peptides at pH 14.0 RRKKQ? (please provide detailed step-by-step solution) 1. Draw detailed structures of the 5-amino-acids peptides 2. Identify pKa values of all ionizable functional groups
I did not understand soultion for the question.. The relationship between Affinity and Association & Dissociation Constant. Four proteins (A-D) all bind the same ligand (X), with different affinities. For protein A & B we know that they have a binding site for X with a Kd (dissociation constant) of 10⁻⁵and 10⁻⁸ M, respectively. For protein C and D we know that they have a binding site for ligand X with a Ka (association constant) of 10³and 10⁵M, respectively. Which protein has the highest affinity for ligand ? Explain your reasoning. How do you make them all in same constant so that values can be compared and the one with highest Ka or lowest Kd (Highest affinity in both cases) can be ruled out.
Relationship between Affinity and Association & Dissociation Constant. Four proteins (A-D) all bind the same ligand (X), with different affinities. For protein A & B we know that they have a binding site for X with a Kd (dissociation constant) of 10-5and 10-8M, respectively. For protein C and D we know that they have a binding site for ligand X with a Ka (association constant) of 103and 105M, respectively. Which protein has the highest affinity for ligand X? Explain your reasoning.
Using the information below, determine the amino acid sequence of the peptide, and explain how your structure is consistent with each piece of information. Complete hydrolysis by 6 M HCl at 110°C followed by amino acid analysis indicated the presence of Gly, Leu, Phe, and Tyr in a 2:1:1:1 molar ratio. Treatment of the peptide with1-fluoro-2,4-dinitrobenzene followed by complete hydrolysis and chromatography indicated the presence of the 2,4-dinitrophenyl derivative of tyrosine. No free tyrosine could be found. Complete digestion of he peptide with pepsin (which cleaves on the amino side of aromatic residues) followed by chromatography yielded a dipeptide containing Phe and Leu and a tripeptide containing Tyr and Gly in a 1:2 ratio.
The pKa values of an amino acid are the following: pK1 = 2.18; pK2 = 8.95; pK3 = 10.53, what is the isoelectric point of the amino acid? Show the solution and express the your answer in three significant figures.
What are the nonprotein nitrogen components of the blood. Give their chemical structures and relative physiologic concentrations and describe their biosynthesis and excretion. Kindy insert your references. Thank you!