ND STONY BROOK UNIVERSITY LOOSELEAF GENETICS: FROM GENES TO GENOMES
6th Edition
ISBN: 9781260406092
Author: HARTWELL, Leland, HOOD, Leroy, Goldberg, Michael
Publisher: Mcgraw-hill Education/stony Brook University
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 18, Problem 23P
Geneticists are currently considering using technologies described in this chapter to de-extinct the woolly mammoth, a species that disappeared roughly 4000 years ago.
a. | Frozen specimens of woolly mammoths have been found in the Siberian tundra. If intact, living cells could be obtained from these samples, how could you attempt to bring back these long-extinct animals using these cells and oocytes from Asian elephants, a closely related species? |
b. | Scientists have determined the genome sequence of the mammoth from frozen samples. These researchers are now trying to understand the adaptations that allowed these creatures to survive extreme cold. For example, mammoths had much thicker hair than do any elephants. How in theory could you use CRISPR/Cas9 to investigate the genetic basis of the difference in hair thickness between mammoths and elephants? |
c. | How (again in theory) might it be possible to extend the CRISPR/Cas9 technique to de-extinct the mammoth? What kinds of technical challenges are involved in this approach? Why do you think some people consider the idea of de-extinction to be unethical? |
Expert Solution & Answer
![Check Mark](/static/check-mark.png)
Want to see the full answer?
Check out a sample textbook solution![Blurred answer](/static/blurred-answer.jpg)
Students have asked these similar questions
Woolly mammoths have been extinct for about 4,000 years, but we often find their well-preserved remains in Siberian permafrost. Research groups are now planning to use SCNT to resurrect these huge elephant-like mammals. No mammoth eggs have been recovered yet, so elephant eggs would be used instead. An elephant would also be the surrogate mother for the resulting embryo. The researchers may try a modified SCNT technique used to clone a mouse that had been dead and frozen for 16 years. Ice crystals that form during freezing break up cell membranes, so cells from the frozen mouse were in bad shape. Their DNA was transferred into donor mouse eggs, and cells from the resulting embryos were fused with undifferentiated mouse cells. Four healthy clones were born from the hybrid embryos. What are some of the pros and cons of cloning an extinct animal?
Wooly Mammoths have been extinct for about 10,000 years; however, their remains have been well persevered in Siberia. Due to global warming, these remains are now available to be recovered. Scientists want to extract the DNA and through cloning insert the DNA into an elephant to clone the mammoth. What are some of the pros and cons of cloning an extinct animal?
Bioinformatics is an interdisciplinary field that integrates knowledge of computer science
with mathematics and statistics to solve biological questions. Many bioinformatics tools
for gene prediction, homology modelling and such are available free online.
(1) What does BLAST stand for?
(ii)
Explain the function of BLAST.
Chapter 18 Solutions
ND STONY BROOK UNIVERSITY LOOSELEAF GENETICS: FROM GENES TO GENOMES
Ch. 18 - Match each of the terms in the left column to the...Ch. 18 - Mice are usually gray, but a mouse geneticist has...Ch. 18 - Sometimes, genes transferred into the mouse genome...Ch. 18 - In mice, a group of so-called Hox genes encode...Ch. 18 - The fly eyes shown in Fig. 18.7 are malformed...Ch. 18 - This problem concerns a technique called enhancer...Ch. 18 - Fish and other organisms that live in the Arctic...Ch. 18 - a. Describe two ways you could potentially make a...Ch. 18 - Figure 18.6 shows a picture of Glofish ,...Ch. 18 - Some people are concerned about the possible...
Ch. 18 - The goal of the Knockout Mouse Project is to...Ch. 18 - Prob. 12PCh. 18 - Prob. 13PCh. 18 - a. Which genome manipulation technique would you...Ch. 18 - a. Diagram a knockin construct that could have...Ch. 18 - Prob. 16PCh. 18 - Prob. 17PCh. 18 - The transcription factor Pax6 is required...Ch. 18 - Mouse models for human genetic diseases are...Ch. 18 - One way to determine where inside a cell a protein...Ch. 18 - In Problem 5 in Chapter 17, you saw that a SNP...Ch. 18 - Scientists now routinely use CRISPR/Cas9 to make...Ch. 18 - Geneticists are currently considering using...Ch. 18 - a. Figures 18.9 and 18.12 demonstrated methods to...Ch. 18 - Nonhomologous end-joining NHEJ of a double-strand...Ch. 18 - One problem that researchers sometimes encounter...Ch. 18 - Researchers at the University of California at San...Ch. 18 - Prob. 28PCh. 18 - F. Port and S. Bullock at the University of...Ch. 18 - On Fig 18.14, locate the PAM site and identify the...Ch. 18 - Prob. 31PCh. 18 - Prob. 32PCh. 18 - Recall that Leber congenital amaurosis LCA, a form...Ch. 18 - One potential strategy for gene therapy to correct...Ch. 18 - Recently, scientists have used a mouse model for...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Different mutations in the WDR62 gene that inactivate gene function were found in the genomes of many different people with microcephaly. This information provided strong support for the idea that the WDR62 gene mutation causes microcephaly. A.The human genome sequence identified WDR62 as one of the approximately 27, 000 genes in the human genome. What information about the function of WDR62 do you think was learned originally from the DNA sequence of the normal human genome?arrow_forwardThe human genome contains more than a million copies of the Alu transposable element. Comparative genomics reveals that the Alu element is found only in the clade of mammals that includes primates, tree shrews,rodents, and rabbits. a. What does the observation that the Alu transposon is limited to this clade reveal about its origin and method of spread among species? b. At many sites in the genome, an Alu element is present in humans but absent in chimpanzees, while at many other sites an Alu element is present in chimpanzees but absent in humans. What are two hypotheses that could explain this situation? For any particular site,how could the hypotheses be distinguished?arrow_forwardIt has been suggested that it would make the study of human diseases easier if cloned transgenic animals were produced that carried faulty versions of human genes (e.g., the gene that causes cystic fibrosis). a. Why would such animals be useful in medical research? : b. What ethical questions are raised by the creation of such transgenic animals?arrow_forward
- A mouse gene was identified and determined to be required for formation of heart muscle. A gene with a similar sequence was identified in the human genome. What experiment could scientists do to determine if the mouse and human genes have similar functions? A. The scientist could place the normal human gene into normal mice and see if the resulting mice are viable. B. The scientist could search the human genome for genes that encode proteins that are identical to the protein encoded by the mouse gene. C. The scientist could place the normal human gene into mutant mice to see if heart muscle forms in the mouse. D. The scientist could place the mutant mouse gene into humans to see if humans develop without heart muscle.arrow_forwardIn comparison to experimental results from the genetic manipulation of an invertebrate model, what pathologic outcome(s) would suggest that multiple homologs of a disease gene are present in humans? a. Missing the essential gene homolog that is lethal in fruit flies is also lethal in human infants. b. Different homologs of the essential gene are each expressed in different human organs, and mutations in these duplicated genes cause organ-specific diseases. c. Different homologs of the essential gene are each expressed in different stages of early child development, and mutations in each of these duplicated genes cause different diseases. d. In humans, defects in different homologs of the essential gene cause different loss-of-function diseases due to subfunctionalization. e. The essential gene is lethal in fruit flies, but there is no disease phenotype exhibited in people.arrow_forwarda. What type of nucleic acid and from what species would the scientist use to begin construction of her genomic DNA library? b. From what tissue would she isolate this nucleic acid? c. What type of reagent would the scientist use to cut the genome into appropriately sized fragments? d. What size nucleic acid fragments would one aim to prepare for the library construction so as to to avoid having to screen an overwhelming number of clones? e. Into what vector would the scientist ligate her genomic DNA fragments? f. What organism would the scientist use to propagate the clones of her genomic DNA library? g. From the information given in the problem determine what probe could be used to screen the scientist's library to find her clone of interest ?arrow_forward
- a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forward1a) Why is it possible for you to study the eye colour gene by extracting cheek cells? a. Because the nucleus of every cell in the human body contains the same genetic information. b. Because the cheek cells are located near the cells of the eye and so they are able to exchange DNA. c. Because all genes in the human body are expressed at all times so it is easy to study them. d. All of the above are possible explanations. 1b) What is the purpose of heating the sample to 75°C following addition of the 0.2M NaOH solution? a. To denature the histone proteins that are keeping the DNA tightly coiled. b. To ensure that all the DNA is removed from the swab in preparation for PCR. c. To breakdown the cheek cell membrane to release the DNA from the cell. d. It breaks down the circular DNA down into linear fragments so that they will be easier to visualize.iarrow_forwardGive typing answer with explanation and conclusion If you want to identify genes linked to autism in a mouse model, which genetic approach or approaches could you use? (Mark all that apply) A) Reverse Genetics B) Forward Genetics C) Optogenetics D) Population Geneticsarrow_forward
- You have sequenced the genome of the bacterium Salmonella typhimurium, and you are using BLAST analysis to identify similarities within the S. typhimurium genome to known proteins. You find a protein that is 100 percent identical in the bacterium Escherichia coli. When you compare nucleotide sequences of the S. typhimurium and E. coli genes, you find that their nucleotide sequences are only 87 percent identical.a. Explain this observation.b. What do these observations tell you about the merits of nucleotide- versus protein-similarity searches in identifying related genes?arrow_forwardWhat did the Hershey / Chase experiments (above) demonstrate about the molecules responsible for genetic inheritance patterns in the T2 bacteriophage? A. the genetic material consists of carbohydrates, not RNA B. the genetic material consists of protein, not lipids C. the genetic material consists of DNA, not polypeptides D. the genetic material consists of protein, not DNA E. the genetic material consists of lipids, not polypeptidesarrow_forwardGenome duplications outside plants are relatively rare; and have only occurred a few times throughout evolutionary history. When they do occur, they tend to coincide with a change in a geological period; which is also a time of upheaval and natural change (ie. the Cretaceous–Paleogene boundary which was most likely caused by an asteroid that wiped out three-quarters of all species of life, including the dinosaurs). Which of the following statements is TRUE? A. Genome duplications are more common in plants because plants can self-fertilize B. Genome duplications are usually strongly selected against, because of problems with meiosis C. All of the statements are true D. Genome duplications allow for increased variation for selection to act on, which is beneficial in stressful environmentsarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
![Text book image](https://www.bartleby.com/isbn_cover_images/9780134580999/9780134580999_smallCoverImage.gif)
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
![Text book image](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
![Text book image](https://www.bartleby.com/isbn_cover_images/9781259398629/9781259398629_smallCoverImage.gif)
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
![Text book image](https://www.bartleby.com/isbn_cover_images/9780815344322/9780815344322_smallCoverImage.gif)
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260159363/9781260159363_smallCoverImage.gif)
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260231700/9781260231700_smallCoverImage.gif)
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education
The Evolution of Populations: Natural Selection, Genetic Drift, and Gene Flow; Author: Professor Dave Explains;https://www.youtube.com/watch?v=SRWXEMlI0_U;License: Standard YouTube License, CC-BY
The Evolution of Humans | Evolution | Biology | FuseSchool; Author: FuseSchool - Global Education;https://www.youtube.com/watch?v=Vf_dDp7drFg;License: Standard YouTube License, CC-BY