![EBK GENERAL, ORGANIC, AND BIOLOGICAL CH](https://www.bartleby.com/isbn_cover_images/8220100853180/8220100853180_largeCoverImage.jpg)
Concept explainers
(a)
Interpretation: The classification of the given standard amino acid as hydrophobic or hydrophilic has to be stated.
Concept introduction: The amino acid that has one
The amino acid that has one amine group, one carboxyl group and a polar side chain is called polar amino acid. The polar amino acid is soluble in water. Thus, it is hydrophilic in nature.
(b)
Interpretation: The classification of the given standard amino acid as hydrophobic or hydrophilic has to be stated.
Concept introduction: The amino acid that has one amine group, one carboxyl group and nonpolar side chain is called non-polar amino acid. The non-polar amino acid is not soluble in water. Thus, it is hydrophobic in nature.
The amino acid that has one amine group, one carboxyl group and a polar side chain is called polar amino acid. The polar amino acid is soluble in water. Thus, it is hydrophilic in nature.
(c)
Interpretation: The classification of the given standard amino acid as hydrophobic or hydrophilic has to be stated.
Concept introduction: The amino acid that has one amine group, one carboxyl group and nonpolar side chain is called non-polar amino acid. The non-polar amino acid is not soluble in water. Thus, it is hydrophobic in nature.
The amino acid that has one amine group, one carboxyl group and a polar side chain is called polar amino acid. The polar amino acid is soluble in water. Thus, it is hydrophilic in nature.
(d)
Interpretation: The classification of the given standard amino acid as hydrophobic or hydrophilic has to be stated.
Concept introduction: The amino acid that has one amine group, one carboxyl group and nonpolar side chain is called non-polar amino acid. The non-polar amino acid is not soluble in water. Thus, it is hydrophobic in nature.
The amino acid that has one amine group, one carboxyl group and a polar side chain is called polar amino acid. The polar amino acid is soluble in water. Thus, it is hydrophilic in nature.
![Check Mark](/static/check-mark.png)
Want to see the full answer?
Check out a sample textbook solution![Blurred answer](/static/blurred-answer.jpg)
Chapter 20 Solutions
EBK GENERAL, ORGANIC, AND BIOLOGICAL CH
- The figure below shows the titration curve for the amino acid aspartic acid. There are five key points in the titration designated with roman numerals. For each of the statements following the figure, identify the appropriate key point of the titrationarrow_forwardThe bacterially produced antibiotic gramicidin A forms channels in cell membranes that allow the free diff usion of Na+ and K+ ions, thereby killing the cell. This peptide consists of a sequence of Dand L-amino acids. The sequence of a segment of fi ve amino acids in gramicidin A is R-Gly-L-Ala-D-Leu-L-Ala-D-Val-R′. Complete the Fischer projection below by adding the correct group to each vertical bond.arrow_forwardThe R group in alanine is –CH3, whereas the R group in aspartic acid is -CH2CO2H. After consulting Figure 1-34, draw thecomplete Lewis structure for each of these amino acids.arrow_forward
- Why are amino acids called a-amino acids and why are they designTed as L-form?arrow_forwardSuppose that the sequence is part of a larger globular protein. Consider the probable location, either on the external surface or the interior of the protein, of each of the amino acid residues. The table gives the hydropathy index values for selected amino acids in the peptide. Amino acid Hydropathy index alanine 1.8 isoleucine 4.5 threonine -0.7 glutamine -3.5 lysine -3.9 aspartate -3.5arrow_forwardLEFT:You have the following titration curve of an amino acid with a non-polar R-group with arrows on curve from (1) to (5). RIGHT: This amino acid has the following structures (a) to (e)) at different points of the titration curve. Match each numbered arrow on the curve (from (1) to (5)) with the appropriate amino acid structure (from (a) to (e)) 12 (5) H.NCHCOH + HNCHCO (a) 10 (4) CH3 CH Isoelectrin HŃCHCO + (b) ppint 43) HNCHCO CH3 CH3 (2) HaNCHCOH H. NCHCO (e) (d CH3 CH3 0.0 0.5 1.0 15 20 NaOH equivalents. H-NCHCO (e) CH3arrow_forward
- What are the sequences of all the possibletripeptides that contain the amino acids aspartic acid, leucine, andphenylalanine? Use the three-letter abbreviations to express youranswer.arrow_forwardWrite the following oligopeptide using the one letter code for the amino acids: Cys-His-lle-Leu-Glu N.B. Use upper case characters only, pleasearrow_forwardConsider the peptide Trp-Arg-Glu-Cys-Gly-Tyr. For the drawings requested below, please show them in zig-zag style, from amino to carboxy terminus, with correct stereochemistry Draw the predominant form at pH = 2 Draw the predominant form at pH = 5 Draw the predominant form at pH = 7 Draw the predominant form at pH = 12arrow_forward
- Identify the following amino acid at pH = 7 (aqueous form): (COO-)–CH(NH3+)–CH2–(COO-) aspartic acid asparagine histidine arginine lysinearrow_forwardDraw a complete structural representation for the tetrapeptide Phe-Met-Tyr-Asn (NOTE:use the zwitterion form) Give the IUPAC name for the tetrapeptide formation of F-M-Y-N. List all the possible tetrapeptide formed from one of each amino acids Phe-Met-Tyr-Asn? (NOTE: Use the three letter abbreviation code for the amino acids in answering D)arrow_forwardYou are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280?? or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280??? Select the best answer. Measuring absorbance at higher wavelengths, like 595?? or 562??, is more accurate than measuring absorbance at…arrow_forward
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
![Text book image](https://www.bartleby.com/isbn_cover_images/9780134580999/9780134580999_smallCoverImage.gif)
![Text book image](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)
![Text book image](https://www.bartleby.com/isbn_cover_images/9781259398629/9781259398629_smallCoverImage.gif)
![Text book image](https://www.bartleby.com/isbn_cover_images/9780815344322/9780815344322_smallCoverImage.gif)
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260159363/9781260159363_smallCoverImage.gif)
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260231700/9781260231700_smallCoverImage.gif)