![EBK GENERAL, ORGANIC, AND BIOLOGICAL CH](https://www.bartleby.com/isbn_cover_images/8220100853180/8220100853180_largeCoverImage.jpg)
EBK GENERAL, ORGANIC, AND BIOLOGICAL CH
7th Edition
ISBN: 8220100853180
Author: STOKER
Publisher: CENGAGE L
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 20, Problem 20.16EP
With the help of Table 20-1, classify each of the standard amino acids in Problem 20-10 as hydrophobic or hydrophilic.
Expert Solution & Answer
![Check Mark](/static/check-mark.png)
Want to see the full answer?
Check out a sample textbook solution![Blurred answer](/static/blurred-answer.jpg)
Students have asked these similar questions
Provide the 20 amino acids in this format:
Histidine is an amino acid with three titratable groups: an -NH3+ group (pKa = 9.2), a -COOH group (pKa = 1.8), and an imidazole (amine-like) group (pKa = 6.0). The titration curve for histidine is shown below with four points highlighted. (a) Identify which point on the titration curve corresponds to the pKa for each of the titratable groups, and which point corresponds to the pI. Explain your choices. (b) Calculate the value of pI for histidine
The bacterially produced antibiotic gramicidin A forms channels in cell membranes that allow the free diff usion of Na+ and K+ ions, thereby killing the cell. This peptide consists of a sequence of Dand L-amino acids. The sequence of a segment of fi ve amino acids in gramicidin A is R-Gly-L-Ala-D-Leu-L-Ala-D-Val-R′. Complete the Fischer projection below by adding the correct group to each vertical bond.
Chapter 20 Solutions
EBK GENERAL, ORGANIC, AND BIOLOGICAL CH
Ch. 20.1 - Prob. 1QQCh. 20.1 - Proteins are naturally occurring unbranched...Ch. 20.2 - Prob. 1QQCh. 20.2 - How do the various standard amino acids differ...Ch. 20.2 - The number of carboxyl groups and amino groups...Ch. 20.2 - How many different subclassifications are there...Ch. 20.2 - Which of the following statements concerning...Ch. 20.3 - Prob. 1QQCh. 20.3 - Proteins from plant sources are a. always complete...Ch. 20.3 - Prob. 3QQ
Ch. 20.4 - Prob. 1QQCh. 20.4 - Which of the following groups is positioned at the...Ch. 20.4 - Which of the following statements concerning...Ch. 20.5 - Which of the standard amino acids exist as...Ch. 20.5 - Which of the following is the zwitterion ion...Ch. 20.5 - Which of the following is the structural form for...Ch. 20.6 - Prob. 1QQCh. 20.6 - Prob. 2QQCh. 20.7 - The joining together of two amino acids to form a...Ch. 20.7 - The number of peptide bonds present in a...Ch. 20.7 - Which of the following statements concerning the...Ch. 20.7 - Prob. 4QQCh. 20.7 - How many isomeric tripeptides can be formed from...Ch. 20.8 - The two best-known peptide hormones present in the...Ch. 20.8 - Which of the following peptides is an important...Ch. 20.9 - The term protein is generally reserved for...Ch. 20.9 - Prob. 2QQCh. 20.9 - Which of the following is not a distinguishing...Ch. 20.10 - Specifying the primary structure of a protein...Ch. 20.10 - Prob. 2QQCh. 20.10 - Prob. 3QQCh. 20.11 - Prob. 1QQCh. 20.11 - Prob. 2QQCh. 20.11 - Prob. 3QQCh. 20.12 - Prob. 1QQCh. 20.12 - Hydrophobic interactions associated with protein...Ch. 20.12 - R group interactions between which of the...Ch. 20.13 - Prob. 1QQCh. 20.13 - Which of the following types of interactions does...Ch. 20.14 - The complete hydrolysis of a protein produces a...Ch. 20.14 - Which of the following statements concerning...Ch. 20.15 - Which of the following levels of protein structure...Ch. 20.15 - Which of the following does not involve protein...Ch. 20.15 - Prob. 3QQCh. 20.16 - Prob. 1QQCh. 20.16 - Prob. 2QQCh. 20.16 - Prob. 3QQCh. 20.16 - In which of the following pairs of proteins are...Ch. 20.17 - Insulin and human growth hormone are examples of...Ch. 20.17 - Myoglobin and transferrin are examples of a....Ch. 20.17 - Prob. 3QQCh. 20.18 - Prob. 1QQCh. 20.18 - Prob. 2QQCh. 20.18 - Prob. 3QQCh. 20.19 - Prob. 1QQCh. 20.19 - Which of the following types of plasma...Ch. 20.19 - Prob. 3QQCh. 20 - Prob. 20.1EPCh. 20 - What element is always present in proteins that is...Ch. 20 - What percent of a cells overall mass is accounted...Ch. 20 - Approximately how many different proteins are...Ch. 20 - What is signified when an amino acid is designated...Ch. 20 - What functional groups are present in all -amino...Ch. 20 - Indicate whether or not each of the following...Ch. 20 - Indicate whether or not each of the following...Ch. 20 - How many carbon atoms are present in the R group...Ch. 20 - How many carbon atoms are present in the R group...Ch. 20 - With the help of Table 20-1, determine the name...Ch. 20 - With the help of Table 20-1, determine the name...Ch. 20 - With the help of Table 20-1, classify each of the...Ch. 20 - With the help of Table 20-1, classify each of the...Ch. 20 - Prob. 20.15EPCh. 20 - With the help of Table 20-1, classify each of the...Ch. 20 - Prob. 20.17EPCh. 20 - Prob. 20.18EPCh. 20 - Prob. 20.19EPCh. 20 - Prob. 20.20EPCh. 20 - Prob. 20.21EPCh. 20 - How many amino groups and how many carboxyl groups...Ch. 20 - Prob. 20.23EPCh. 20 - Which two of the standard amino acids are...Ch. 20 - Prob. 20.25EPCh. 20 - Prob. 20.26EPCh. 20 - Prob. 20.27EPCh. 20 - Prob. 20.28EPCh. 20 - Prob. 20.29EPCh. 20 - Prob. 20.30EPCh. 20 - Indicate whether or not the designation...Ch. 20 - Indicate whether or not the designation...Ch. 20 - Prob. 20.33EPCh. 20 - Prob. 20.34EPCh. 20 - To which family of mirror-image isomers do nearly...Ch. 20 - In what way is the structure of glycine different...Ch. 20 - Draw Fischer projection formulas for the following...Ch. 20 - Draw Fischer projection formulas for the following...Ch. 20 - Answer the following questions about the amino...Ch. 20 - Answer the following questions about the amino...Ch. 20 - At room temperature, amino acids are solids with...Ch. 20 - At room temperature, most amino acids are not very...Ch. 20 - Prob. 20.43EPCh. 20 - Draw the zwitterion structure for each of the...Ch. 20 - Draw the structure of serine at each of the...Ch. 20 - Prob. 20.46EPCh. 20 - Prob. 20.47EPCh. 20 - Most amino acids have isoelectric points between...Ch. 20 - Glutamic acid exists in two low-pH forms instead...Ch. 20 - Arginine exists in two high-pH forms instead of...Ch. 20 - In a low-pH aqueous solution, indicate whether...Ch. 20 - Prob. 20.52EPCh. 20 - When two cysteine molecules dimerize, what happens...Ch. 20 - What chemical reaction involving the cysteine...Ch. 20 - What two functional groups are involved in the...Ch. 20 - Write a generalized structural representation for...Ch. 20 - For the tripeptide GlyAlaCys a. What amino acid is...Ch. 20 - For the tripeptide SerValMet a. What amino acid is...Ch. 20 - Prob. 20.59EPCh. 20 - Prob. 20.60EPCh. 20 - Draw a complete condensed structural...Ch. 20 - Draw a complete condensed structural...Ch. 20 - With the help of Table 20-1, identify the amino...Ch. 20 - With the help of Table 20-1, identify the amino...Ch. 20 - With the help of Table 20-1, assign an IUPAC name...Ch. 20 - With the help of Table 20-1, assign an IUPAC name...Ch. 20 - Prob. 20.67EPCh. 20 - Prob. 20.68EPCh. 20 - For the tripeptide AlaValGly which amino acid...Ch. 20 - For the tripeptide SerArgIle which amino acid...Ch. 20 - Consider the tripeptide tyrosylleucylisoleucine....Ch. 20 - Consider the tripeptide leucylvalyltryptophan. a....Ch. 20 - Explain why the notations SerCys and CysSer...Ch. 20 - Explain why the notations AlaGlyValAla and...Ch. 20 - Prob. 20.75EPCh. 20 - There are a total of six different amino acid...Ch. 20 - Compare the structures of the protein hormones...Ch. 20 - Compare the protein hormones oxytocin and...Ch. 20 - Compare the binding-site locations in the brain...Ch. 20 - Compare the structures of the peptide...Ch. 20 - Prob. 20.81EPCh. 20 - Prob. 20.82EPCh. 20 - What is the major difference between a monomeric...Ch. 20 - What is the major difference between a simple...Ch. 20 - Prob. 20.85EPCh. 20 - Prob. 20.86EPCh. 20 - Prob. 20.87EPCh. 20 - Two proteins with the same amino acid composition...Ch. 20 - How many different primary structures are possible...Ch. 20 - How many different primary structures are possible...Ch. 20 - How many different primary structures are possible...Ch. 20 - How many different primary structures are possible...Ch. 20 - Prob. 20.93EPCh. 20 - Draw a segment of the backbone of a protein that...Ch. 20 - Prob. 20.95EPCh. 20 - In a pleated sheet secondary structure for a...Ch. 20 - Indicate whether each of the following statements...Ch. 20 - Indicate whether each of the following statements...Ch. 20 - Prob. 20.99EPCh. 20 - Prob. 20.100EPCh. 20 - State the four types of attractive forces that...Ch. 20 - Prob. 20.102EPCh. 20 - Prob. 20.103EPCh. 20 - Prob. 20.104EPCh. 20 - Prob. 20.105EPCh. 20 - Prob. 20.106EPCh. 20 - Prob. 20.107EPCh. 20 - Prob. 20.108EPCh. 20 - Prob. 20.109EPCh. 20 - Not all proteins have quaternary structure....Ch. 20 - Prob. 20.111EPCh. 20 - Prob. 20.112EPCh. 20 - Prob. 20.113EPCh. 20 - Prob. 20.114EPCh. 20 - Prob. 20.115EPCh. 20 - Prob. 20.116EPCh. 20 - Prob. 20.117EPCh. 20 - Prob. 20.118EPCh. 20 - Identify the primary structure of a hexapeptide...Ch. 20 - Identify the primary structure of a hexapeptide...Ch. 20 - Draw structural formulas for the products obtained...Ch. 20 - Prob. 20.122EPCh. 20 - Which structural levels of a protein are affected...Ch. 20 - Prob. 20.124EPCh. 20 - In what way is the protein in a cooked egg the...Ch. 20 - Why is cooked protein more easily digested than...Ch. 20 - Indicate whether or not each of the following...Ch. 20 - Prob. 20.128EPCh. 20 - Prob. 20.129EPCh. 20 - Contrast fibrous and globular proteins in terms of...Ch. 20 - Classify each of the following proteins as a...Ch. 20 - What is the major biochemical function of each of...Ch. 20 - Prob. 20.133EPCh. 20 - Prob. 20.134EPCh. 20 - Prob. 20.135EPCh. 20 - Prob. 20.136EPCh. 20 - Prob. 20.137EPCh. 20 - Where are the carbohydrate units located in...Ch. 20 - Prob. 20.139EPCh. 20 - Prob. 20.140EPCh. 20 - Prob. 20.141EPCh. 20 - Prob. 20.142EPCh. 20 - Prob. 20.143EPCh. 20 - Describe the process by which blood...Ch. 20 - Prob. 20.145EPCh. 20 - Prob. 20.146EPCh. 20 - Prob. 20.147EPCh. 20 - Prob. 20.148EPCh. 20 - Prob. 20.149EPCh. 20 - Prob. 20.150EPCh. 20 - Prob. 20.151EPCh. 20 - Prob. 20.152EP
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- The figure below shows the titration curve for the amino acid aspartic acid. There are five key points in the titration designated with roman numerals. For each of the statements following the figure, identify the appropriate key point of the titrationarrow_forwardWhy are amino acids called a-amino acids and why are they designTed as L-form?arrow_forwardThe R group in alanine is –CH3, whereas the R group in aspartic acid is -CH2CO2H. After consulting Figure 1-34, draw thecomplete Lewis structure for each of these amino acids.arrow_forward
- Suppose that the sequence is part of a larger globular protein. Consider the probable location, either on the external surface or the interior of the protein, of each of the amino acid residues. The table gives the hydropathy index values for selected amino acids in the peptide. Amino acid Hydropathy index alanine 1.8 isoleucine 4.5 threonine -0.7 glutamine -3.5 lysine -3.9 aspartate -3.5arrow_forwardWhat are the sequences of all the possibletripeptides that contain the amino acids aspartic acid, leucine, andphenylalanine? Use the three-letter abbreviations to express youranswer.arrow_forwardLEFT:You have the following titration curve of an amino acid with a non-polar R-group with arrows on curve from (1) to (5). RIGHT: This amino acid has the following structures (a) to (e)) at different points of the titration curve. Match each numbered arrow on the curve (from (1) to (5)) with the appropriate amino acid structure (from (a) to (e)) 12 (5) H.NCHCOH + HNCHCO (a) 10 (4) CH3 CH Isoelectrin HŃCHCO + (b) ppint 43) HNCHCO CH3 CH3 (2) HaNCHCOH H. NCHCO (e) (d CH3 CH3 0.0 0.5 1.0 15 20 NaOH equivalents. H-NCHCO (e) CH3arrow_forward
- Write the following oligopeptide using the one letter code for the amino acids: Cys-His-lle-Leu-Glu N.B. Use upper case characters only, pleasearrow_forwardс" CH2 CH2 "НaN H с. CH С" CH Нзс CHз ZI о-оarrow_forwardDraw a complete structural representation for the tetrapeptide Phe-Met-Tyr-Asn (NOTE:use the zwitterion form) Give the IUPAC name for the tetrapeptide formation of F-M-Y-N. List all the possible tetrapeptide formed from one of each amino acids Phe-Met-Tyr-Asn? (NOTE: Use the three letter abbreviation code for the amino acids in answering D)arrow_forward
- Identify the following amino acid at pH = 7 (aqueous form): (COO-)–CH(NH3+)–CH2–(COO-) aspartic acid asparagine histidine arginine lysinearrow_forwardConsider the peptide Trp-Arg-Glu-Cys-Gly-Tyr. For the drawings requested below, please show them in zig-zag style, from amino to carboxy terminus, with correct stereochemistry Draw the predominant form at pH = 2 Draw the predominant form at pH = 5 Draw the predominant form at pH = 7 Draw the predominant form at pH = 12arrow_forwardYou are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280?? or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280??? Select the best answer. Measuring absorbance at higher wavelengths, like 595?? or 562??, is more accurate than measuring absorbance at…arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
![Text book image](https://www.bartleby.com/isbn_cover_images/9780134580999/9780134580999_smallCoverImage.gif)
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
![Text book image](https://www.bartleby.com/isbn_cover_images/9781947172517/9781947172517_coverImage_Textbooks.gif)
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
![Text book image](https://www.bartleby.com/isbn_cover_images/9781259398629/9781259398629_smallCoverImage.gif)
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
![Text book image](https://www.bartleby.com/isbn_cover_images/9780815344322/9780815344322_smallCoverImage.gif)
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260159363/9781260159363_smallCoverImage.gif)
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
![Text book image](https://www.bartleby.com/isbn_cover_images/9781260231700/9781260231700_smallCoverImage.gif)
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education
Biomolecules - Protein - Amino acids; Author: Tutorials Point (India) Ltd.;https://www.youtube.com/watch?v=ySNVPDHJ0ek;License: Standard YouTube License, CC-BY