EBK CONCEPTS OF GENETICS
12th Edition
ISBN: 9780134818979
Author: Killian
Publisher: YUZU
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 21, Problem 13PDQ
Through the Human Genome Project (HGP), a relatively accurate human genome sequence was published from combined samples from multiple individuals. It serves as a reference for a haploid genome. How do results from personal genome projects (PGP) differ from those of the HGP?
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Do all of them
True/False 31) The process by which an electrical charge is used to introduce DNA into a cell to produce a transgenic organism is called electroporation.Answer: 32) Reproductive cloning is used to produce large amounts of mammalian proteins from transgenic agricultural animals such as cattle.Answer: 33) In gene addition, homologous recombination is used to remove the original gene and replace it with the cloned gene.Answer: 34) All stem cells have the potential to differentiateAnswer: 35) A bone marrow transplant involves the transfer of multipotent stem cellsAnswer: 36) The fact that in mammalian systems multiple genes may compensate for the loss of a gene is called gene redundancy.Answer:
What is Human Genome Project? What are its goals and benefits? What are the ethical, legal, and social concerns in sequencing human genome?
In 1995, the first free-living organism to have its genome completely sequenced was Haemophilus influenzae, a bacteria. In the following year, the baker’s yeast Saccharomyces cerevisiae was the first eukaryote genome sequence to be fully sequenced. The complete sequencing of the human genome and related organisms represent one of the greatest scientific achievements in the history of mankind.Elaborate on the importance of genome studies in general.
Chapter 21 Solutions
EBK CONCEPTS OF GENETICS
Ch. 21 - In a sequence encompassing 99.4 percent of the...Ch. 21 - Annotation of a proteome attempts to relate each...Ch. 21 - Because of its accessibility and biological...Ch. 21 - If you had Crohns disease or ulcerative colitis...Ch. 21 - Prob. 2CSCh. 21 - Prob. 3CSCh. 21 - HOW DO WE KNOW? In this chapter, we focused on the...Ch. 21 - CONCEPT QUESTION Review the Chapter Concepts list...Ch. 21 - What is functional genomics? How does it differ...Ch. 21 - Compare and contrast WGS to a map-based cloning...
Ch. 21 - What is bioinformatics, and why is this discipline...Ch. 21 - Annotation involves identifying genes and...Ch. 21 - Prob. 7PDQCh. 21 - BLAST searches and related applications are...Ch. 21 - What functional information about a genome can be...Ch. 21 - Describe three major goals of the Human Genome...Ch. 21 - Describe the human genome in terms of genome size,...Ch. 21 - The Human Genome Project has demonstrated that in...Ch. 21 - Through the Human Genome Project (HGP), a...Ch. 21 - Explain differences between whole-genome...Ch. 21 - Describe the significance of the Genome 10K...Ch. 21 - Prob. 16PDQCh. 21 - Prob. 17PDQCh. 21 - What are DNA microarrays? How are they used?Ch. 21 - Prob. 19PDQCh. 21 - Prob. 20PDQCh. 21 - Researchers have compared candidate loci in humans...Ch. 21 - Homology can be defined as the presence of common...Ch. 21 - Prob. 23ESPCh. 21 - Prob. 24ESPCh. 21 - Whole-exome sequencing (WES) is helping physicians...Ch. 21 - Recall that when the HGP was completed, more than...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Describe two of the applications for genome mapping.arrow_forwardIf you were offered the chance to have the genome of your newborn sequenced at a cost of 1,000, would you do so?arrow_forwardDescribe the goals, processes, and outcomes of the Human Genome Project. Who were the major "players" involved? What were the successes and challenges?arrow_forward
- Describe three major goals of the Human Genome Project.arrow_forwardDiscuss the sequencing technology used to resolve the human genome in 2005, its significant advantages and limitations?arrow_forwardwhich of the following statements about genome-wide association studies (GWAS) is correct? A) involves scanning the genomes of thousands of unrelated individuals with a particular mutation and comparing them with the genomes of individuals who do not have the mutation. B) involves scanning the genomes of thousands of unrelated individuals with a particular disease and comparing them with the genomes of individuals who do not have the disease C) attempt to identify genes that influence mutation risk D) attempt to identify genes that influence disease risk E) involves scanning the genomes of thousands of unrelated individuals with a particular disease and comparing them with the genomes of individuals who do not have the disease and GWAS attempt to identify genes that influence disease riskarrow_forward
- What are some of the ethical concerns arising out of the information produced by the Human Genome Project?arrow_forwardWhat are the two methods used for sequencing in Human genome project.arrow_forwardWhat is the purpose of the Human Genome Project? Why do researchers want to know the details of the human genome?arrow_forward
- Explain how the different “-omics” involved with the three major parts of the central dogma can be used to study this new species. What are molecular techniques/tools (sequencers) that can be used to study each of these? How would you sequence the genome efficiently (i.e., lowest amount of time and money)?arrow_forwardWhat are the overall benefits/consequences of the Human Genome Project and the ability to quickly perform DNA sequencing?arrow_forwarda) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage LearningConcepts of BiologyBiologyISBN:9781938168116Author:Samantha Fowler, Rebecca Roush, James WisePublisher:OpenStax College
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Concepts of Biology
Biology
ISBN:9781938168116
Author:Samantha Fowler, Rebecca Roush, James Wise
Publisher:OpenStax College
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License