SAPLINGPLUS F/BIOCHEM+ICLICKER REEF-CODE
SAPLINGPLUS F/BIOCHEM+ICLICKER REEF-CODE
9th Edition
ISBN: 9781319398583
Author: BERG
Publisher: MAC HIGHER
bartleby

Concept explainers

bartleby

Videos

Question
Book Icon
Chapter 31, Problem 1P
Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer
Check Mark

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!
Students have asked these similar questions
PLEASE ANSWER WHY? Some substitution mutation result in a malfunctioning protein but others do not. Why is this? 
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon  in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
Structural Stability of DNA  True or false Hydrophobic bonding between stacked purine and pyrimidine Hydrogen bonding between purine and pyrimidine bases Hydrogen bonding between adjacent pyrimidine bases tRNA  True or false A given tRNA can be charged with only one particular amino acid The anticodon of tRNA finds the complementary codon on mRNA The amino acid is attached to end of tRNA The amino acid is recognized by the anticodon of tRNA
Knowledge Booster
Background pattern image
Biochemistry
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.
Similar questions
SEE MORE QUESTIONS
Recommended textbooks for you
  • Text book image
    Biochemistry
    Biochemistry
    ISBN:9781305577206
    Author:Reginald H. Garrett, Charles M. Grisham
    Publisher:Cengage Learning
    Text book image
    Biology (MindTap Course List)
    Biology
    ISBN:9781337392938
    Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
    Publisher:Cengage Learning
Text book image
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Text book image
Biology (MindTap Course List)
Biology
ISBN:9781337392938
Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg
Publisher:Cengage Learning
DNA vs RNA (Updated); Author: Amoeba Sisters;https://www.youtube.com/watch?v=JQByjprj_mA;License: Standard youtube license