ACTIVITY 3. POINT MUTATION Directions: Translate the genes in the TRNA into amino acids. Then, combine the symbol assigned to the amino acids to form words. Determine what mutation will be represented if the letters are combined. Encircle the shifting/errors on words and write the type of mutation on the blank provided. Refer to the table given on your flash drive. (file name: LP5-Activity 3) Sample Guide: GGA CGU GGG GCA CUU + PAPRD. INVERSION _1. CCA GCA CUA CGU CUU AUU UGU CUC UUA AUU UCU CUC UGC UCC CUU CGU UGC word/s formed 2. GUA CGA AGA GUG UGA CGA CCA AUC UGC UAG UUC UGA UUC CUU GCA word/s formed 3. UAG ACU GAU GUG CGU UGC CUU ACU ACG GUG CUU CGU UGA CUU UCC word/s formed 4. CGA UGA UGG UAG UGA CUG CUU AUU UUC CGA word/s formed: _5. GGG CGC GGA CGG CGU AGA AUC UCG CGU AUC AGU ACG UAG CUU UUG ACG CUU word/s formed

ACTIVITY 3. POINT MUTATION Directions: Translate the genes in the TRNA into amino acids. Then, combine the symbol assigned to the amino acids to form words. Determine what mutation will be represented if the letters are combined. Encircle the shifting/errors on words and write the type of mutation on the blank provided. Refer to the table given on your flash drive. (file name: LP5-Activity 3) Sample Guide: GGA CGU GGG GCA CUU + PAPRD. INVERSION _1. CCA GCA CUA CGU CUU AUU UGU CUC UUA AUU UCU CUC UGC UCC CUU CGU UGC word/s formed 2. GUA CGA AGA GUG UGA CGA CCA AUC UGC UAG UUC UGA UUC CUU GCA word/s formed 3. UAG ACU GAU GUG CGU UGC CUU ACU ACG GUG CUU CGU UGA CUU UCC word/s formed 4. CGA UGA UGG UAG UGA CUG CUU AUU UUC CGA word/s formed: _5. GGG CGC GGA CGG CGU AGA AUC UCG CGU AUC AGU ACG UAG CUU UUG ACG CUU word/s formed

Biology 2e

2nd Edition

ISBN:9781947172517

Author:Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:Matthew Douglas, Jung Choi, Mary Ann Clark

Chapter14: Dna Structure And Function

Section: Chapter Questions

Problem 37CTQ: An adult with a history of tanning has his genome sequenced. The beginning of a protein-coding...

See similar textbooks

Similar questions

Instruction - Please answer them correctly - Please answer all of them, they are connected. MUTATION Fill in the correct nucleotide base pairing and amino acid sequence of the mutated DNA a. What is the 3’-5’ DNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) b. What is the mRNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) c. What is the tRNA sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) d. What is the amino acid sequence? (FORMAT: XXX-XXX-XXX-XXX-XXX) e. What is the most convincing type of mutation had occurred? (Frameshift resulting Missense; Frameshift resulting Nonsense; Substitution – Silent; Substitution – Missense; Substitution – Nonsense)
An adult with a history of tanning has his genome sequenced. The beginning of a protein-coding region of his DNA reads ATGGGGATATGGCAT. If the protein-coding region of a healthy adult reads ATGGGGATATGAGCAT, identify the site and type of mutation.
INSTRUCTION: = IF BOTH STATEMENT ARE TRUE = IF FIRST STATEMENT IS TRUE WHILE SECOND STATEMENT IS FALSE = IF FIRST STATEMENT IS FALSE WHILE SECOND STATEMENT IS TRUE = IF BOTH STATEMENTS ARE FALSE STAMENT 1: Amino acyl tRNA synthase is the enzyme responsible for joining amino acid together STAMENT 2: Nucleus is the part of the cell where translation takes place ANSWER: STAMENT 1: DNA sequences where RNA polymerase binds initially is called promoter sequences STAMENT 2: UV light causes adenine to dimerize ANSWER: STAMENT 1: Guanosine is the name of the compound formed when guanine is bonded to ribose STAMENT 2: DNA pairing is the term that refers to the process when two complementary and single stranded DNA combine ANSWER:
For each mutant, state what change has occurred in the DNA, whether it was a substitution by transition or transversion, sense mutation, nonsense or reading frame change. It must present the codon sequence. Normal nucleotide sequence starting from the third codon: CCC-ACG-GUG-ACG-ACA-CGG-UGG Please show the codon and nucleotide sequence of the mutation.
Give typing answer with explanation and conclusion Which of the following statements regarding the structure and function of tRNA is true? A-The codon / anticodon pairing is absolutely universal among organism. B-The charging of a tRNA does not require energy. C-There are 64 different tRNAs, one for each possible codon. D-Reading 5' to 3', the first base in the anticodon can participate in non Watson and Crick base pairing E- The 3' end of each tRNA has a unique sequence so a specific amino acid can be attached.
Good afternoon, Guidance with this question would be most appriciated. Thank you for your time. Polypeptide sequences are formed from 20 amino acids. What is the probability that a single point mutation in a gene will result in a different polypeptide sequence?
90. If the mRNA sequence is 5' - START(AUG) - UUU - AAA - AGU - GGU - 3' , then what is the corresponding tRNA anticodon sequence? A.5' - UAC - AAA - UUU - UCA - CCA- 3' B.3' - UAC - AAA - UUU - UCA - CCA- 5' C.5' - CCA - AAA - TTT - TCA - TAC - 3' D.3' - TAC - AAA - TTT - TCA - CCA- 5'
Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________
Mutated DNA Sequence #1 T A C A T C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this?
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
17. All of the following occur when the amino acids of two tRNA molecules are joined, except. a. The tRNA in the first position is released to get a new amino acid b. The mRNA molecules bring amino acids to the ribosome to be joined to the growing polypeptide c. The growing polypeptide is attached to the tRNA in the second position d. The mRNA is pulled through the ribosome so that the tRNA with the protein chain goes into the first position
Hi, Could you please comfirm the following question. I have selected option c) because tRNA is the the complimentary pairs of mRNA so I figured the oppside end of the tRNA would be the same as the mRNA. When I have tired to double check my answer, no tutor has selected this answer. Thank you in advance, Like mRNA, tRNA has a ribose sugar, U instead of T, and is single stranded. Unlike mRNA, which remains a long single strand of nucleotides, tRNA folds so that some areas pair up. The resulting structure has an anticodon on one end and a site for an amino acid to attach on the other end. There is base complementarity (A pairs with U and G pairs with C) between an mRNA codon and tRNA anticodon.If the amino acid lysine attaches to a tRNA, which of the following anticodons could be at the opposite end of the tRNA molecule? a. UUU and UUC b. AGA and AGU c. AAA and AAG d. UCU and UCA